Date published: 2026-4-2

1-800-457-3801

SCBT Portrait Logo
Seach Input

gasdermin Antikörper (H-6): sc-376318

4.5(4)
Produkt bewertenBitte stellen Sie eine Frage

Datenblätter
  • gasdermin Antikörper H-6 ist ein Maus monoklonales IgG1 κ gasdermin Antikörper, verwendet in 9 wissenschaftlichen Veröffentlichungen, in einer Menge von 200 µg/ml
  • gezogen gegen die Aminosäuresequenz 1-196 lokalisiert am N-terminus von gasdermin aus der Spezies human
  • gasdermin Antikörper (H-6) ist empfohlen für die Detektion von gasdermin A aus der Spezies mouse, rat und human per WB, IP, IF und ELISA
  • Anti-gasdermin Antikörper (H-6) ist erhältlich als Konjugat mit Agarose für IP; HRP für WB, IHC(P) und ELISA; und entweder mit Phycoerythrin oder FITC für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 oder Alexa Fluor® 647 für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 680 oder Alexa Fluor® 790 für WB (NIR), IF und FCM
  • auch konjugiert erhältlich mit Biotin für WB, IHC(P) und ELISA
  • Aktuell testen wir noch unsere Sekundärantikörper um das beste Bindeprotein für diesen Primärantikörper gasdermin (H-6) zu finden. Kontaktieren Sie uns bitte, wenn Sie Fragen hierzu haben sollten.
Gene Editing Promo Banner

Direktverknüpfungen

Siehe auch...

Gasdermin-Antikörper (H-6) ist ein monoklonaler Maus IgG1 κ Gasdermin-Antikörper (auch als Gasdermin-Antikörper bezeichnet), der das Gasdermin-Protein von Maus-, Ratte- und menschlicher Herkunft mittels WB, IP, IF und ELISA nachweist. Gasdermin-Antikörper (H-6) ist sowohl in nicht konjugierter Form als auch in mehreren konjugierten Formen des Gasdermin-Antikörpers erhältlich, darunter Agarose, HRP, PE, FITC und mehrere Alexa Fluor®-Konjugate. Gasdermin, auch bekannt als GSDMA, GSDM oder FKSG9, ist ein 445 Aminosäure langes Protein, das sich in der perinukleären Region des Zytoplasmas lokalisiert und zur Gasdermin-Familie gehört. Es wird hauptsächlich in Geweben des Gastrointestinaltrakts exprimiert und ist auch in Haut und Mamma-Drüse vorhanden. Gasdermin induziert Apoptose und wird angenommen, dass es eine Tumorunterdrückungsaktivität, insbesondere in Magenkrebszellen, besitzt. Das Gen, das Gasdermin codiert, wird auf dem menschlichen Chromosom 17 abgebildet, das über 2,5% des menschlichen Genoms ausmacht und über 1.200 Gene codiert. Zwei wichtige Tumorsuppressorgene sind mit dem Chromosom 17 verbunden, nämlich p53 und BRCA1. Der Tumorsuppressor p53 ist für die Erhaltung der zellulären genetischen Integrität durch die Modulation des Zellschicksals durch DNA-Reparatur versus Zelltod erforderlich. Eine Fehlfunktion oder ein Verlust der p53-Expression ist mit malignem Zellwachstum und dem Li-Fraumeni-Syndrom verbunden. Wie p53 ist BRCA1 direkt an der DNA-Reparatur beteiligt, wird aber spezifisch als genetischer Determinant für ein frühzeitiges Brustkrebsrisiko und eine Prädisposition für Krebserkrankungen der Eierstöcke, des Kolons, der Prostata und der Eileiter erkannt.

Ausschließlich für Forschungszwecke. Nicht für diagnostische oder therapeutische Zwecke bestimmt.

Alexa Fluor® ist ein Markenzeichen von Molecular Probes Inc., OR., USA

LI-COR® und Odyssey® sind Markenzeichen von LI-COR Biosciences

gasdermin Antikörper (H-6) Literaturhinweise:

  1. Gasdermin (Gsdm), das auf dem Maus-Chromosom 11 lokalisiert ist, wird vorwiegend im oberen Magen-Darm-Trakt exprimiert, aber in menschlichen Magenkrebszellen deutlich unterdrückt.  |  Saeki, N., et al. 2000. Mamm Genome. 11: 718-24. PMID: 10967128
  2. Der evolutionäre Rekombinations-Hotspot um den GSDML-GSDM-Locus ist eng mit dem onkogenomischen Rekombinations-Hotspot um das PPP1R1B-ERBB2-GRB7-Amplikon verbunden.  |  Katoh, M. and Katoh, M. 2004. Int J Oncol. 24: 757-63. PMID: 15010812
  3. Mitglieder einer neuen Genfamilie, Gsdm, werden ausschließlich im Epithel der Haut und des Magen-Darm-Trakts in einer sehr gewebespezifischen Weise exprimiert.  |  Tamura, M., et al. 2007. Genomics. 89: 618-29. PMID: 17350798
  4. GASDERMIN, das bei Magenkrebs häufig unterdrückt wird, ist ein Ziel von LMO1 bei der TGF-beta-abhängigen apoptotischen Signalgebung.  |  Saeki, N., et al. 2007. Oncogene. 26: 6488-98. PMID: 17471240
  5. Unterschiedliche Expression und Funktion von vier Genen der GSDM-Familie (GSDMA-D) in normalem und malignem oberen Magen-Darm-Epithel.  |  Saeki, N., et al. 2009. Genes Chromosomes Cancer. 48: 261-71. PMID: 19051310
  6. Caspase-11 spaltet Gasdermin D für nicht-kanonische Inflammasomsignale.  |  Kayagaki, N., et al. 2015. Nature. 526: 666-71. PMID: 26375259
  7. Porenbildende Aktivität und strukturelle Autoinhibition der Gasdermin-Familie.  |  Ding, J., et al. 2016. Nature. 535: 111-6. PMID: 27281216
  8. Pyroptose: Gasdermin-vermittelter programmierter nekrotischer Zelltod.  |  Shi, J., et al. 2017. Trends Biochem Sci. 42: 245-254. PMID: 27932073
  9. Chemotherapeutika induzieren Pyroptose durch Caspase-3-Spaltung eines Gasdermins.  |  Wang, Y., et al. 2017. Nature. 547: 99-103. PMID: 28459430
  10. Molekulare Mechanismen der Poren bildenden Aktivität von Gasdermin D.  |  Devant, P. and Kagan, JC. 2023. Nat Immunol. 24: 1064-1075. PMID: 37277654
  11. Gasdermin und MLKL als Auslöser des nekrotischen Zelltods: Signalübertragung und Krankheiten.  |  Lawlor, KE., et al. 2024. Immunity. 57: 429-445. PMID: 38479360
  12. Intraepitheliale Mastzellen fördern die Gasdermin C-vermittelte Typ-2-Immunität.  |  Yang, L., et al. 2024. Immunity. 57: 1056-1070.e5. PMID: 38614091

Bestellinformation

ProduktKatalog #EINHEITPreisANZAHLFavoriten

gasdermin Antikörper (H-6)

sc-376318
200 µg/ml
CNY2422.00

gasdermin Antikörper (H-6) AC

sc-376318 AC
500 µg/ml, 25% agarose
CNY3189.00

gasdermin Antikörper (H-6) HRP

sc-376318 HRP
200 µg/ml
CNY2422.00

gasdermin Antikörper (H-6) FITC

sc-376318 FITC
200 µg/ml
CNY2527.00

gasdermin Antikörper (H-6) PE

sc-376318 PE
200 µg/ml
CNY2625.00

gasdermin Antikörper (H-6) Alexa Fluor® 488

sc-376318 AF488
200 µg/ml
CNY2738.00

gasdermin Antikörper (H-6) Alexa Fluor® 546

sc-376318 AF546
200 µg/ml
CNY2738.00

gasdermin Antikörper (H-6) Alexa Fluor® 594

sc-376318 AF594
200 µg/ml
CNY2738.00

gasdermin Antikörper (H-6) Alexa Fluor® 647

sc-376318 AF647
200 µg/ml
CNY2738.00

gasdermin Antikörper (H-6) Alexa Fluor® 680

sc-376318 AF680
200 µg/ml
CNY2738.00

gasdermin Antikörper (H-6) Alexa Fluor® 790

sc-376318 AF790
200 µg/ml
CNY2738.00

gasdermin Antikörper (H-6) B

sc-376318 B
200 µg/ml
CNY2452.00

Necesito el anticuerpo para usarlo en Inmunohistquimica. Tiene disponible el anticuerpo para esa técnica?

Gefragt von: Anonym
Deberá ponerse en contacto con su distribuidor local. A continuación se muestra un enlace a su información de contacto. https://www.scbt.com/resources/distributors
Beantwortet von: Technical Service
Veröffentlichungsdatum: 2024-10-11

Is the gasdermin Antibody (H-6) recommended with m-IgG Fc BP-HRP, m-IgG1 BP-HRP or m-IgGκ BP-HRP by any chance?

Gefragt von: Fern
Thank you for your question. At present, we have not yet completed the identification of the preferred secondary detection reagent(s) for gasdermin Antibody (H-6). This work is in progress.
Beantwortet von: BlakeJ
Veröffentlichungsdatum: 2024-07-22

For western blots, should I dilute the primary antibody in 5% w/v nonfat dry milk, 1X TBS, 0.1% Tween® 20 or just T-TBS? Thank you

Gefragt von: tonytony
Thank you for your question. For blocking we recommend UltraCruz® Blocking Reagent: sc-516214. Otherwise, milk-based blocking buffers are best suited for a broad blocking effect reducing unspecific signals, or BSA-based blocking if signals are specific but comparatively faint. Contact our technical service team directly for further assistance.
Beantwortet von: Tech Support Europe
Veröffentlichungsdatum: 2023-06-14

Does the antibody recognize cleaved form of GSDMD? Such as N-term (p30) and C-term (p23)? Thanks!

Gefragt von: tuuu
Thank you for the question. Gasdermin is a 445 amino acid protein This clone (H-6) was raised against amino acids 1-196 mapping at the N-terminus of human Gasdermin. Epitope mapping has not been carried out for this antibody. Therefore the exact binding region within the below sequence and reactivity with cleaved GSDMDs has not been determined, yet: MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVT
Beantwortet von: Technical Support Europe
Veröffentlichungsdatum: 2017-12-27

What is the recommended fixation method for immunofluorescence staining with gasdermin (H-6): sc-376318 monoclonal antibody?

Gefragt von: Germaine
Thank you for your inquiry. We recommend fixing cells for 5 minutes in -10°C methanol and allowing to air dry. The full protocol can be viewed here: https://www.scbt.com/scbt/resources/protocols/immunofluorescence-cell-staining
Beantwortet von: Technical Support
Veröffentlichungsdatum: 2017-02-24
  • y_2026, m_4, d_1, h_12CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_5
  • loc_de_DE, sid_376318, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 96ms
  • QUESTIONS, PRODUCT
Rated 3 von 5 von aus GasderminNice antibody-Gasdermin H-6 detects 53kd band with the mouse liver lysate-1:400 dil in 5% SM.
Veröffentlichungsdatum: 2017-05-19
Rated 5 von 5 von aus This is the recommended gasdermin monoclonalWorks as expected in Western blotting and Immunofluoresence on mouse, rat an human samples
Veröffentlichungsdatum: 2017-02-01
Rated 5 von 5 von aus Produced excellent immunofluorescence cytoplasmicProduced excellent immunofluorescence cytoplasmic staining in methanol-fixed HeLa cells. -SCBT QC
Veröffentlichungsdatum: 2015-05-01
Rated 5 von 5 von aus Produced positive Western Blot data of gasderminProduced positive Western Blot data of gasdermin expression in non-transfected and mouse gasdermin transfected 293 whole cell lysates. -SCBT QC
Veröffentlichungsdatum: 2013-09-11
  • y_2026, m_4, d_1, h_12
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_4
  • loc_de_DE, sid_376318, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 8ms
  • REVIEWS, PRODUCT
gasdermin Antikörper (H-6) wurde bewertet mit 4.5 von 5 von 4.
  • y_2026, m_4, d_1, h_12
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_4
  • loc_de_DE, sid_376318, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 97ms
  • REVIEWS, PRODUCT