Date published: 2026-4-4

1-800-457-3801

SCBT Portrait Logo
Seach Input

VIP Antikörper (H-6): sc-25347

4.9(11)
Produkt bewertenBitte stellen Sie eine Frage

Datenblätter
  • VIP Antikörper H-6 ist ein Maus monoklonales IgG2b κ VIP Antikörper, verwendet in 38 wissenschaftlichen Veröffentlichungen, in einer Menge von 200 µg/ml
  • gezogen gegen die Aminosäuresequenz 1-95 von vasoactive intestinal peptide (VIP) aus der Spezies human
  • VIP Antikörper (H-6) ist empfohlen für die Detektion von VIP aus der Spezies human per WB, IP, IF, IHC(P) und ELISA
  • Anti-VIP Antikörper (H-6) ist erhältlich als Konjugat mit Agarose für IP; HRP für WB, IHC(P) und ELISA; und entweder mit Phycoerythrin oder FITC für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 oder Alexa Fluor® 647 für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 680 oder Alexa Fluor® 790 für WB (NIR), IF und FCM
  • 2b BP-HRP">m-IgG2b BP-HRP und m-IgGκ BP-HRP sind die bevorzugten sekundären Nachweisreagenzien für VIP Antikörper (H-6) für WB- und IHC(P)-Anwendungen. Diese Reagenzien werden jetzt in Bündeln mit VIP Antikörper (H-6) angeboten(siehe Bestellinformationen unten).
Gene Editing Promo Banner

Direktverknüpfungen

Siehe auch...

Der VIP-Antikörper (H-6) ist ein monoklonaler IgG2b-Antikörper der leichten Kette Kappa aus Mäusen, der für den Nachweis des humanen vasoaktiven intestinalen Peptids (VIP) entwickelt wurde, das auch als PHM27 oder Glucagon-Familienmitglied bekannt ist. Der monoklonale VIP-Antikörper (H-6) wird gegen die Aminosäuren 1–95 des VIP-Proteins gebildet, wodurch eine präzise Bindung und hohe Affinität bei verschiedenen experimentellen Techniken wie Western Blot (WB), Immunpräzipitation (IP), Immunfluoreszenz (IF), Immunhistochemie mit in Paraffin eingebetteten Schnitten (IHCP) und Enzyme-linked Immunosorbent Assay (ELISA) gewährleistet wird. Das vasoaktive intestinale Peptid spielt eine entscheidende Rolle bei der Entspannung der glatten Muskulatur und der Vasodilatation, wodurch es den Blutdruck reguliert und die Wasser- und Elektrolytsekretion im Darm fördert, was seine Bedeutung in der kardiovaskulären und gastrointestinalen Forschung unterstreicht. Über seine vasodilatatorischen Effekte hinaus ist VIP ein wesentlicher Bestandteil der Neuroprotektion und der Modulation des Immunsystems und weist entzündungshemmende Eigenschaften auf, was den VIP (H-6)-Antikörper zu einem Schlüsselinstrument in verschiedenen physiologischen Prozessen und potenziellen therapeutischen Anwendungen macht. Der monoklonale VIP-Antikörper (H-6) ist sowohl in nicht konjugierter als auch in mehrfach konjugierter Form erhältlich, einschließlich Meerrettichperoxidase (HRP), Phycoerythrin (PE), Fluoresceinisothiocyanat (FITC) und verschiedenen Alexa Fluor®-Farbstoffen, was Flexibilität für eine Vielzahl von Versuchsaufbauten bietet. Der Anti-VIP-Antikörper (H-6) ermöglicht es Wissenschaftlern, die Mechanismen, an denen VIP beteiligt ist, effektiv zu untersuchen und potenzielle therapeutische Ziele für Erkrankungen im Zusammenhang mit Vasodilatation, Immunregulation und Entzündungsreaktionen zu identifizieren.

Ausschließlich für Forschungszwecke. Nicht für diagnostische oder therapeutische Zwecke bestimmt.

Alexa Fluor® ist ein Markenzeichen von Molecular Probes Inc., OR., USA

LI-COR® und Odyssey® sind Markenzeichen von LI-COR Biosciences

VIP Antikörper (H-6) Literaturhinweise:

  1. Unterschiedliche Verarbeitung von Proglucagon durch die Subtilisin-ähnlichen Prohormonkonvertasen PC2 und PC3, um entweder Glucagon oder glucagonähnliches Peptid zu erzeugen.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. Expression und funktionelle Aktivität von Glucagon, glucagonähnlichem Peptid I und glukoseabhängigen insulinotropen Peptidrezeptoren in Inselzellen des Pankreas der Ratte.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. Glukoseintoleranz, aber normales Sättigungsgefühl bei Mäusen mit einer Null-Mutation im Glucagon-like Peptide 1 Rezeptor-Gen.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. Vasoaktives intestinales Peptid (VIP) stimuliert in vitro das Wachstum von VIP-1-Rezeptor-tragenden menschlichen Adenokarzinomzellen der Bauchspeicheldrüse.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. Spezifische Merkmale des Glykogenstoffwechsels in der Leber.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. Hypophysen-Adenylatzyklase-aktivierendes Polypeptid (PACAP) 38 und PACAP27 aktivieren gemeinsame und unterschiedliche intrazelluläre Signalwege zur Stimulierung der Wachstumshormonsekretion von somatotropen Schweinen.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

Bestellinformation

ProduktKatalog #EINHEITPreisANZAHLFavoriten

VIP Antikörper (H-6)

sc-25347
200 µg/ml
CNY2422.00

VIP (H-6): m-IgGκ BP-HRP Bundle

sc-520782
200 µg Ab, 40 µg BP
CNY2715.00

VIP (H-6): m-IgG2b BP-HRP Bundle

sc-548853
200 µg Ab; 10 µg BP
CNY2715.00

VIP Antikörper (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
CNY3189.00

VIP Antikörper (H-6) HRP

sc-25347 HRP
200 µg/ml
CNY2422.00

VIP Antikörper (H-6) FITC

sc-25347 FITC
200 µg/ml
CNY2527.00

VIP Antikörper (H-6) PE

sc-25347 PE
200 µg/ml
CNY2625.00

VIP Antikörper (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
CNY2738.00

VIP Antikörper (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
CNY2738.00

VIP Antikörper (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
CNY2738.00

VIP Antikörper (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
CNY2738.00

VIP Antikörper (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
CNY2738.00

VIP Antikörper (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
CNY2738.00

Can you take a picture of the product‘s package? Can' t find it after cleaning the lab...

Gefragt von: Anonym
Thank you for your question. Please contact our Technical Service Department. Our Asian Technical Service team is available at (+86) 021-60936350 or [email protected] or by live chat on our website.
Beantwortet von: Sen Li
Veröffentlichungsdatum: 2026-01-30

Hi, does this antibody work with IHC on free floating sections from mouse?

Gefragt von: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email [email protected].
Beantwortet von: BlakeJ
Veröffentlichungsdatum: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Gefragt von: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Beantwortet von: Tech Support Europe
Veröffentlichungsdatum: 2021-09-13

Did you test this antibody in flowcytometry ?

Gefragt von: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Beantwortet von: Tech Service
Veröffentlichungsdatum: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Gefragt von: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Beantwortet von: Tech Service
Veröffentlichungsdatum: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Gefragt von: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Beantwortet von: Technical Support
Veröffentlichungsdatum: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Gefragt von: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Beantwortet von: SCBT Heidelberg Support
Veröffentlichungsdatum: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Gefragt von: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Beantwortet von: Technical Support Europe
Veröffentlichungsdatum: 2018-01-10
  • y_2026, m_3, d_31, h_9CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_9
  • loc_de_DE, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 95ms
  • QUESTIONS, PRODUCT
Rated 5 von 5 von aus Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Veröffentlichungsdatum: 2024-11-07
Rated 5 von 5 von aus Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Veröffentlichungsdatum: 2023-02-02
Rated 5 von 5 von aus It looked greatI ordered this a month ago and it worked great! I will purchase again
Veröffentlichungsdatum: 2018-05-04
Rated 5 von 5 von aus Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Veröffentlichungsdatum: 2018-01-31
Rated 5 von 5 von aus GoodThe analysis results of WB were very stong and clear, it worked well for WB
Veröffentlichungsdatum: 2017-06-08
Rated 5 von 5 von aus Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Veröffentlichungsdatum: 2017-01-11
Rated 4 von 5 von aus Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Veröffentlichungsdatum: 2015-07-08
Rated 5 von 5 von aus Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Veröffentlichungsdatum: 2015-06-02
  • y_2026, m_3, d_31, h_9
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_de_DE, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 11ms
  • REVIEWS, PRODUCT
VIP Antikörper (H-6) wurde bewertet mit 4.9 von 5 von 11.
  • y_2026, m_3, d_31, h_9
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_de_DE, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 129ms
  • REVIEWS, PRODUCT