Date published: 2025-12-16

00800 4573 8000

SCBT Portrait Logo
Seach Input

Ribosomal Protein S6 Antikörper (C-8): sc-74459

4.8(35)
Produkt bewertenBitte stellen Sie eine Frage

Datenblätter
  • Ribosomal Protein S6 Antikörper C-8 ist ein Maus monoklonales IgG2b κ Ribosomal Protein S6 Antikörper, verwendet in 181 wissenschaftlichen Veröffentlichungen, in einer Menge von 200 µg/ml
  • gegen Aminosäuren 1-249 kodiert, die an N-terminus von Ribosomal Protein S6 von human Ursprung
  • Ribosomal Protein S6 Antikörper (C-8) ist empfohlen für die Detektion von 40S Ribosomal Protein S6 aus der Spezies mouse, rat und human per WB, IP, IF, IHC(P) und ELISA
  • Anti-Ribosomal Protein S6 Antikörper (C-8) ist erhältlich als Konjugat mit Agarose für IP; HRP für WB, IHC(P) und ELISA; und entweder mit Phycoerythrin oder FITC für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 oder Alexa Fluor® 647 für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 680 oder Alexa Fluor® 790 für WB (NIR), IF und FCM
  • 2b BP-HRP">m-IgG2b BP-HRP und m-IgGκ BP-HRP sind die bevorzugten sekundären Nachweisreagenzien für Ribosomal Protein S6 Antikörper (C-8) für WB- und IHC(P)-Anwendungen. Diese Reagenzien werden jetzt in Bündeln mit Ribosomal Protein S6 Antikörper (C-8) angeboten(siehe Bestellinformationen unten).

Direktverknüpfungen

Siehe auch...

Ribosomal Protein S6 Antibody (C-8) ist ein monoklonaler IgG2b-Kappa-Leichtketten-Antikörper aus Mäusen, der für den Nachweis von Ribosomal Protein S6 (RPS6), auch bekannt als S6, entwickelt wurde, einem entscheidenden Bestandteil der 40S-ribosomalen Untereinheit, die an der Proteinsynthese beteiligt ist. Der anti-RPS6-Antikörper (C-8) zielt auf das N-terminale Epitop, das die Aminosäuren 1-249 des menschlichen RPS6 umfasst, und gewährleistet eine präzise Erkennung und Bindung. RPS6 spielt eine entscheidende Rolle bei der Regulierung von Zellwachstum und -proliferation, indem es als Hauptsubstrat für S6-Kinasen dient, die es als Reaktion auf verschiedene extrazelluläre Signale phosphorylieren. Diese Phosphorylierung ist für die Steuerung der Proteintranslation und folglich für die Zellfunktion und den Stoffwechsel unerlässlich. Der monoklonale Antikörper RPS6 (C-8) weist eine breite Reaktivität gegenüber verschiedenen Spezies auf und erkennt RPS6 von Mäusen, Ratten und Menschen in verschiedenen Anwendungen, darunter Western Blot (WB), Immunopräzipitation (IP), Immunfluoreszenz (IF), Immunhistochemie mit in Paraffin eingebetteten Schnitten (IHCP) und Enzyme-Linked Immunosorbent Assay (ELISA). Darüber hinaus ist der Anti-RPS6-Antikörper (C-8) sowohl in nicht konjugierter Form als auch in verschiedenen konjugierten Formen wie Agarose, Meerrettichperoxidase (HRP), Phycoerythrin (PE), Fluoresceinisothiocyanat (FITC) und mehreren Alexa Fluor®-Konjugaten erhältlich, was eine vielseitige Einsetzbarkeit für unterschiedliche experimentelle Anforderungen ermöglicht. Die hohe Konservierung von RPS6 in eukaryotischen Arten unterstreicht seine grundlegende Rolle bei der ribosomalen Funktion und der Zellbiologie, was den RPS6 (C-8)-Antikörper zu einem unschätzbaren Werkzeug für die Forschung in Bereichen wie Zellsignalübertragung, Wachstumsregulation und Krankheitsmechanismen macht.

Ausschließlich für Forschungszwecke. Nicht für diagnostische oder therapeutische Zwecke bestimmt.

Alexa Fluor® ist ein Markenzeichen von Molecular Probes Inc., OR., USA

LI-COR® und Odyssey® sind Markenzeichen von LI-COR Biosciences

Ribosomal Protein S6 Antikörper (C-8) Literaturhinweise:

  1. Die cDNA des ribosomalen Proteins S6 aus zwei Aedes-Mücken kodiert für eine carboxyl-terminale Verlängerung, die Histon-H1-Proteinen ähnelt.  |  Hernandez, VP. and Fallon, AM. 1999. Genetica. 106: 263-7. PMID: 10897799
  2. Die Kartierung von sieben intronhaltigen ribosomalen Proteingenen zeigt, dass sie im menschlichen Genom nicht miteinander verbunden sind.  |  Feo, S., et al. 1992. Genomics. 13: 201-7. PMID: 1577483
  3. Regulierung und Funktion der ribosomalen Protein S6-Kinase (S6K) innerhalb von mTOR-Signalnetzwerken.  |  Magnuson, B., et al. 2012. Biochem J. 441: 1-21. PMID: 22168436
  4. Ribosomale Protein S6-Phosphorylierung: Vier Jahrzehnte Forschung.  |  Meyuhas, O. 2015. Int Rev Cell Mol Biol. 320: 41-73. PMID: 26614871
  5. Primärstruktur des ribosomalen Protein-Gens S6 aus Schizosaccharomyces pombe.  |  Gross, T., et al. 1988. Curr Genet. 13: 57-63. PMID: 2834104
  6. Isolierung und Charakterisierung von klonierten cDNAs, die für das menschliche ribosomale Protein S6 kodieren.  |  Lott, JB. and Mackie, GA. 1988. Gene. 65: 31-9. PMID: 2840355
  7. Die phosphoproteomische Analyse des regenerativen Myokards bei Neugeborenen hat die wichtige Rolle von Checkpoint-Kinase 1 über den aktivierenden C1/Ribosomal Protein S6 Kinase b-1-Signalweg von Mammalian Target of Rapamycin aufgedeckt.  |  Fan, Y., et al. 2020. Circulation. 141: 1554-1569. PMID: 32098494
  8. Die Primärstruktur des menschlichen ribosomalen Proteins S6, abgeleitet von einer klonierten cDNA.  |  Heinze, H., et al. 1988. J Biol Chem. 263: 4139-44. PMID: 3279029
  9. Die Rolle der ribosomalen Protein-S6-Kinasen in der Pflanzenhomöostase.  |  Obomighie, I., et al. 2021. Front Mol Biosci. 8: 636560. PMID: 33778006
  10. Die Blockierung der Phosphorylierung des ribosomalen Proteins S6 hemmt die Podozytenhypertrophie und die fokal-segmentale Glomerulosklerose.  |  Li, F., et al. 2022. Kidney Int. 102: 121-135. PMID: 35483522
  11. Eine Insuffizienz des hepatischen ribosomalen Proteins S6 (Rps6) führt zu einer gestörten Gallengangsentwicklung und zum Verlust der Lebensfähigkeit von Hepatozyten; ein Ribosomopathie-ähnlicher Phänotyp, der teilweise p53-abhängig ist.  |  Comerford, SA., et al. 2023. PLoS Genet. 19: e1010595. PMID: 36656901
  12. Die ribosomale Protein S6 Kinase alpha-1 (RPS6KA1) induziert eine Resistenz gegen Venetoclax/Azacitidin bei akuter myeloischer Leukämie.  |  Weidenauer, K., et al. 2023. Leukemia. 37: 1611-1625. PMID: 37414921

Bestellinformation

ProduktKatalog #EINHEITPreisANZAHLFavoriten

Ribosomal Protein S6 Antikörper (C-8)

sc-74459
200 µg/ml
RMB2377.00

Ribosomal Protein S6 (C-8): m-IgGκ BP-HRP Bundle

sc-521117
200 µg Ab, 40 µg BP
RMB2662.00

Ribosomal Protein S6 (C-8): m-IgG2b BP-HRP Bundle

sc-548864
200 µg Ab; 10 µg BP
RMB2662.00

Ribosomal Protein S6 Antikörper (C-8) AC

sc-74459 AC
500 µg/ml, 25% agarose
RMB3129.00

Ribosomal Protein S6 Antikörper (C-8) HRP

sc-74459 HRP
200 µg/ml
RMB2377.00

Ribosomal Protein S6 Antikörper (C-8) FITC

sc-74459 FITC
200 µg/ml
RMB2482.00

Ribosomal Protein S6 Antikörper (C-8) PE

sc-74459 PE
200 µg/ml
RMB2580.00

Ribosomal Protein S6 Antikörper (C-8) Alexa Fluor® 488

sc-74459 AF488
200 µg/ml
RMB2685.00

Ribosomal Protein S6 Antikörper (C-8) Alexa Fluor® 546

sc-74459 AF546
200 µg/ml
RMB2685.00

Ribosomal Protein S6 Antikörper (C-8) Alexa Fluor® 594

sc-74459 AF594
200 µg/ml
RMB2685.00

Ribosomal Protein S6 Antikörper (C-8) Alexa Fluor® 647

sc-74459 AF647
200 µg/ml
RMB2685.00

Ribosomal Protein S6 Antikörper (C-8) Alexa Fluor® 680

sc-74459 AF680
200 µg/ml
RMB2685.00

Ribosomal Protein S6 Antikörper (C-8) Alexa Fluor® 790

sc-74459 AF790
200 µg/ml
RMB2685.00

Is there any citation using this antibody to detect the phosphorylated protein during neuronal activation?

Gefragt von: cyto196
Thank you for your question. It would be helpful if you could call 800-457-3801, allowing for a more interactive discussion of this and other related questions.
Beantwortet von: Technical Service
Veröffentlichungsdatum: 2023-01-05

Has this antibody ever been tested against yeast Rps6?

Gefragt von: Kendall
Thank you for your question. This antibody has not yet been tested in yeast and so that is not a recommended species at this time. We are still gathering data to show on our website. Check back for updates!
Beantwortet von: Dallas Tech Service
Veröffentlichungsdatum: 2021-04-07

is sc-74459 tested in plant?this is my sequence:MKFNIANPTTGCQKKLEIDDDQKLRAFFDKRISQEVSGDALGDEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRNGERRRKSVRGCIVSPDLSVLNLVIVKKGEKDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRNFTTKTGKTASKAPKIQRLVTPLTLQRKRARIADKKKRIAKA

Gefragt von: fakih
Thank you for your question. This antibody has not been tested on plant samples, and based on sequence homology we can not recommend this antibody for plant use.
Beantwortet von: Tech Service
Veröffentlichungsdatum: 2019-04-29

Hi Has this conjugated FITC antibody ever been tested in Flow cytometry? Cheers

Gefragt von: SJT2
We have not yet tested the FITC conjugated antibody in FCM. The conjugated primary antibody is recommended and warrantied for flow cytometry (FCM), however we are still gathering data to show on our website. Check back for updates!
Beantwortet von: Technical Support
Veröffentlichungsdatum: 2019-04-13

Is there any citation using this antibody for IP? Would be easier if you could filter publications accordingly with the technique needed. 

Gefragt von: Ioris
Thanks for your question. You can find the pubblications related to the desired application and much more following this link: https://www.scbt.com/scbt/misc/citationSearch.jsp . Please contact our Technical Service if you need any further support.
Beantwortet von: SCBT Heidelberg Support
Veröffentlichungsdatum: 2019-01-06

Does this antibody work equally in PBS and TBS?

Gefragt von: Muriel74
Thank you for your question. Yes, this product is provided in PBS, but will also work if diluted in TBS. If you have any further questions, please contact our European Technical Service team. You can reach them by phone at Toll Free: +49 6221 4503 0, by email at: [email protected] or by live chat directly on our website, www.scbt.com
Beantwortet von: Tech Service
Veröffentlichungsdatum: 2017-01-12

Are there any issues with using this mouse monoclonal primary antibody on mouse samples?

Gefragt von: AbPolly
Thank you for your inquiry. The use of mouse monoclonal antibodies with mouse samples is very common and typically poses no problem. To eliminate any potential cross-reactivity of an anti-mouse secondary detection reagent, our Ribosomal Protein S6 sc-74459 is available in a variety of direct conjugations, such as HRP, PE, FITC, AlexaFluor 488 and AlexaFluor 647.
Beantwortet von: Technical Support 12
Veröffentlichungsdatum: 2017-01-04
  • y_2025, m_12, d_15, h_4CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_7
  • loc_de_DE, sid_74459, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 106ms
  • QUESTIONS, PRODUCT
Rated 4 von 5 von aus WBでちゃんとバンド出ました今回はWBで抗体を使用しました。 クリアなバンドが、問題なく、検出できました! 今後も使っていきます。
Veröffentlichungsdatum: 2024-10-15
Rated 5 von 5 von aus Good antibodyI bought this antibody as a free sample and it works perfect for western
Veröffentlichungsdatum: 2022-09-02
Rated 5 von 5 von aus Works with yeast S. cerevisae Rps6This antibody has good sensitivity and specificity towards yeast S. cerevisae Rps6. Yeast were grown to log-phase and collected over 5 hrs. Yeast lysates were collected using the culture boiling technique resuspending in 1x loading buffer (30 uL/1.0 OD600*mL cells collected) and loading 8 uL per well (https://doi.org/10.1002/yea.1628). Total protein staining by R-Prob Sigma kit to show consistent protein levels per lane. Antibody used at 1:1000 dilution.
Veröffentlichungsdatum: 2021-07-28
Rated 5 von 5 von aus One of the best s6 antibodiesPerfect for wb, light and defined bands, and rapid development.
Veröffentlichungsdatum: 2021-02-19
Rated 5 von 5 von aus Great for Western BlotI used this antibody for WB analysis of mouse and human samples. Worked very well without non-specific bands
Veröffentlichungsdatum: 2020-12-19
Rated 5 von 5 von aus Excellent antibodyI used this sample to detect S6 protein on A549 and CL1-5 cells and had great bands intensity and specific binding.
Veröffentlichungsdatum: 2020-05-10
Rated 4 von 5 von aus IOutstanding antiibody!We used this antibody to selectively detect total ribosomal protein S6 in PC-3 cells by Western blot. When used at 1:10,000 (in TBST-3% BSA) this antibody yields a single band at the expected MW. Inhibiting mTOR with rapamycin or YM155, as expected, does not inhibit this signal.
Veröffentlichungsdatum: 2020-04-12
Rated 5 von 5 von aus s6 ribosomal proteinSINGLE BAND DETECTED WITH THE EXPECTED MOLECULAR MASS
Veröffentlichungsdatum: 2019-09-12
  • y_2025, m_12, d_15, h_4
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_35
  • loc_de_DE, sid_74459, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 7ms
  • REVIEWS, PRODUCT
Ribosomal Protein S6 Antikörper (C-8) wurde bewertet mit 4.8 von 5 von 35.
  • y_2025, m_12, d_15, h_4
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_35
  • loc_de_DE, sid_74459, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 112ms
  • REVIEWS, PRODUCT