Date published: 2026-4-1

1-800-457-3801

SCBT Portrait Logo
Seach Input

CAP-18 Antikörper (G-1): sc-166055

5.0(3)
Produkt bewertenBitte stellen Sie eine Frage

Datenblätter
  • CAP-18 Antikörper G-1 ist ein Maus monoklonales IgG2a κ CAP-18 Antikörper, verwendet in 10 wissenschaftlichen Veröffentlichungen, in einer Menge von 200 µg/ml
  • gegen Aminosäuren 6-175 kodiert, die an C-terminus von CAP-18 von rat Ursprung
  • CAP-18 Antikörper (G-1) ist empfohlen für die Detektion von CAP-18 aus der Spezies mouse und rat per WB, IP, IF und ELISA
  • Anti-CAP-18 Antikörper (G-1) ist erhältlich als Konjugat mit Agarose für IP; HRP für WB, IHC(P) und ELISA; und entweder mit Phycoerythrin oder FITC für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 oder Alexa Fluor® 647 für IF, IHC(P) und FCM
  • auch erhältlich als Konjugat mit Alexa Fluor® 680 oder Alexa Fluor® 790 für WB (NIR), IF und FCM
  • m-IgG Fc BP-HRP, 2a BP-HRP">m-IgG2a BP-HRP und m-IgGκ BP-HRP sind die bevorzugten sekundären Nachweisreagenzien für CAP-18 Antikörper (G-1) für WB-Anwendungen. Diese Reagenzien werden jetzt in Bündeln mit CAP-18 Antikörper (G-1) angeboten(siehe Bestellinformationen unten).
Gene Editing Promo Banner

Direktverknüpfungen

Siehe auch...

Der CAP-18-Antikörper (G-1) ist ein monoklonaler IgG2a-Kappa-Leichtketten-Antikörper der Maus, der CAP-18 von Mäusen und Ratten durch Western Blot (WB), Immunpräzipitation (IP), Immunfluoreszenz (IF) und Enzyme-linked Immunosorbent Assay (ELISA) nachweist. Der CAP-18 (G-1)-Antikörper ist sowohl in nicht konjugierter als auch in verschiedenen konjugierten Formen erhältlich, darunter Agarose, Meerrettichperoxidase (HRP), Phycoerythrin (PE), Fluoresceinisothiocyanat (FITC) und mehrere Alexa Fluor®-Konjugate. CAP-18, auch bekannt als antimikrobielles Peptid Cathelicidin, spielt eine entscheidende Rolle bei der angeborenen Immunantwort, indem es als antimikrobielles Mittel wirkt, das Infektionen vorbeugt und Entzündungen moduliert. CAP-18 wird hauptsächlich in Neutrophilen, im Knochenmark und in den Hoden exprimiert und ist besonders wichtig bei entzündlichen Hauterkrankungen wie Psoriasis und Dermatitis, bei denen CAP-18 in erhöhten Konzentrationen vorkommt. CAP-18 enthält das antibakterielle Peptid LL-37, das für seine Fähigkeit bekannt ist, eine amphipathische α-helikale Konformation anzunehmen, wodurch CAP-18 effektiv mit bakteriellen Lipopolysacchariden interagieren und Immunzellen an Infektionsherde rekrutieren kann. Die Anwesenheit von LL-37 bei entzündlichen Erkrankungen unterstreicht die Bedeutung von CAP-18 für die Abwehrmechanismen des Wirts und macht den Anti-CAP-18-Antikörper (G-1) zu einem unverzichtbaren Werkzeug für Forscher, die antimikrobielle Peptide und ihre Rolle bei Immunreaktionen untersuchen.

Ausschließlich für Forschungszwecke. Nicht für diagnostische oder therapeutische Zwecke bestimmt.

Alexa Fluor® ist ein Markenzeichen von Molecular Probes Inc., OR., USA

LI-COR® und Odyssey® sind Markenzeichen von LI-COR Biosciences

CAP-18 Antikörper (G-1) Literaturhinweise:

  1. Humanes Cathelicidin, hCAP-18, wird durch extrazelluläre Spaltung mit Proteinase 3 zu dem antimikrobiellen Peptid LL-37 verarbeitet.  |  Sørensen, OE., et al. 2001. Blood. 97: 3951-9. PMID: 11389039
  2. Eine Cathelicidin-Familie des menschlichen antibakteriellen Peptids LL-37 induziert die Chemotaxis von Mastzellen.  |  Niyonsaba, F., et al. 2002. Immunology. 106: 20-6. PMID: 11972628
  3. Die antimikrobiellen Cathelicidin-Peptide werden in Speicheldrüsen und Speichel exprimiert.  |  Murakami, M., et al. 2002. J Dent Res. 81: 845-50. PMID: 12454100
  4. Die Haut von Neugeborenen bei Mäusen und Menschen weist erhöhte Mengen antimikrobieller Peptide auf: angeborene Immunität während der Entwicklung der adaptiven Reaktion.  |  Dorschner, RA., et al. 2003. Pediatr Res. 53: 566-72. PMID: 12612195
  5. Phylogenie, Verarbeitung und Ausdruck des Ratten-Cathelicidins rCRAMP: ein Modell für angeborene antimikrobielle Peptide.  |  Termén, S., et al. 2003. Cell Mol Life Sci. 60: 536-49. PMID: 12737313
  6. Die Cathelicidine - Struktur, Funktion und Evolution.  |  Tomasinsig, L. and Zanetti, M. 2005. Curr Protein Pept Sci. 6: 23-34. PMID: 15638766
  7. Antimikrobielles Cathelicidin-Peptid als serologischer Marker und potenzieller pathogener Faktor bei antineutrophiler zytoplasmatischer Antikörper-assoziierter Vaskulitis.  |  Gasim, A. 2014. Arthritis Res Ther. 16: 105. PMID: 25164257
  8. Das antimikrobielle Peptid Cathelicidin wirkt als Tumorsuppressor beim Leberzellkarzinom.  |  Huang, LH., et al. 2023. Int J Mol Sci. 24: PMID: 37958632
  9. Die Expression des antimikrobiellen Peptids Cathelicidin in Neutrophilen und Neuronen moduliert antagonistisch die Neuroinflammation.  |  Verma, SC., et al. 2024. J Clin Invest. 135: PMID: 39656548
  10. Ein neues murines Cathelin-ähnliches Protein, das im Knochenmark exprimiert wird.  |  Popsueva, AE., et al. 1996. FEBS Lett. 391: 5-8. PMID: 8706928
  11. Identifizierung von CRAMP, einem mit Cathelin verwandten antimikrobiellen Peptid, das in der embryonalen und erwachsenen Maus exprimiert wird.  |  Gallo, RL., et al. 1997. J Biol Chem. 272: 13088-93. PMID: 9148921
  12. Die Expression des Gens, das für das antibakterielle Peptid LL-37 kodiert, wird in menschlichen Keratinozyten bei entzündlichen Erkrankungen induziert.  |  Frohm, M., et al. 1997. J Biol Chem. 272: 15258-63. PMID: 9182550

Bestellinformation

ProduktKatalog #EINHEITPreisANZAHLFavoriten

CAP-18 Antikörper (G-1)

sc-166055
200 µg/ml
CNY2422.00

CAP-18 (G-1): m-IgG Fc BP-HRP Bundle

sc-528899
200 µg Ab; 10 µg BP
CNY2715.00

CAP-18 (G-1): m-IgGκ BP-HRP Bundle

sc-521497
200 µg Ab, 40 µg BP
CNY2715.00

CAP-18 (G-1): m-IgG2a BP-HRP Bundle

sc-547201
200 µg Ab; 10 µg BP
CNY2715.00

CAP-18 Antikörper (G-1) AC

sc-166055 AC
500 µg/ml, 25% agarose
CNY3189.00

CAP-18 Antikörper (G-1) HRP

sc-166055 HRP
200 µg/ml
CNY2422.00

CAP-18 Antikörper (G-1) FITC

sc-166055 FITC
200 µg/ml
CNY2527.00

CAP-18 Antikörper (G-1) PE

sc-166055 PE
200 µg/ml
CNY2625.00

CAP-18 Antikörper (G-1) Alexa Fluor® 488

sc-166055 AF488
200 µg/ml
CNY2738.00

CAP-18 Antikörper (G-1) Alexa Fluor® 546

sc-166055 AF546
200 µg/ml
CNY2738.00

CAP-18 Antikörper (G-1) Alexa Fluor® 594

sc-166055 AF594
200 µg/ml
CNY2738.00

CAP-18 Antikörper (G-1) Alexa Fluor® 647

sc-166055 AF647
200 µg/ml
CNY2738.00

CAP-18 Antikörper (G-1) Alexa Fluor® 680

sc-166055 AF680
200 µg/ml
CNY2738.00

CAP-18 Antikörper (G-1) Alexa Fluor® 790

sc-166055 AF790
200 µg/ml
CNY2738.00

Is there an expected non specific band between 60-70 kDa? I have a very strong band in the area with faint or no bands near the 20-30 kDa range

Gefragt von: pciari
Thank you for your question. We do not expect a nonspecific band. Please contact our Technical Support department to troubleshoot the antibody. Please call (800)-457-3801 or email [email protected]
Beantwortet von: BlakeJ
Veröffentlichungsdatum: 2022-09-07

We intend to detect mCRAMP in mouse kidney tissue by western blot using this antibody. However, in the reference you suggested, CRAMP band is observed at 20KD for PMID#33468624 and #30094093, and at 28kDa for #32682918. What band is desirable to read when

Gefragt von: hongsang38
Thank you for your question. It would be helpful if you could call us, allowing for a more interactive discussion of this and other related questions.
Beantwortet von: Technical Support
Veröffentlichungsdatum: 2021-07-22

Hello. I would like to ask whether the CRAMP Antibody (G-1): sc-166055 recognizes C-terminal antimicrobial peptide released from precursor protein (ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE). Thank you! Piotr

Gefragt von: pkol
Thank you for your question. CRAMP Antibody (G-1): sc-166055 has been raised against amino acids 6-175 mapping at the C-terminus of CRAMP of rat origin. Since this amino acid range corresponds to a longer sequence than the one you have provided, it is possible that the antibody will not bind your sequence. This is a monoclonal antibody, so it only has one distinct epitope within its epitope region. Since no epitope mapping has been performed as of yet, we cannot say whether or not the antibody would recognize the sequence you reference.
Beantwortet von: Tech Support Europe
Veröffentlichungsdatum: 2020-08-28

Can CRAMP (G-1): sc-166055 monoclonal antibody be used in IF or IHC with mouse tissue or cells? Will there be non-specific staining?

Gefragt von: DefinitelyNotMatt
Thank you for your inquiry. The use of mouse monoclonal antibodies with mouse samples is very common and typically poses no problem. To eliminate any potential cross-reactivity of an anti-mouse secondary detection reagent, CRAMP (G-1): sc-166055 is available in a variety of direct conjugations, such as HRP, PE, FITC and AlexaFluors.
Beantwortet von: Technical Support
Veröffentlichungsdatum: 2017-02-24
  • y_2026, m_4, d_1, h_12CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_4
  • loc_de_DE, sid_166055, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 95ms
  • QUESTIONS, PRODUCT
Rated 5 von 5 von aus very clearWonderful results with CRAMP Antibody (G-1) monoclonal antibody, this is good
Veröffentlichungsdatum: 2017-05-19
Rated 5 von 5 von aus strong positive bandStrong positive band observed with CRAMP Antibody (G-1) with little to no background
Veröffentlichungsdatum: 2017-01-31
Rated 5 von 5 von aus Produced nice Western blot data of CRAMPProduced nice Western blot data of CRAMP expression in CSMLO whole cell lysate. -SCBT QC
Veröffentlichungsdatum: 2014-09-10
  • y_2026, m_4, d_1, h_12
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_3
  • loc_de_DE, sid_166055, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT
CAP-18 Antikörper (G-1) wurde bewertet mit 5.0 von 5 von 3.
  • y_2026, m_4, d_1, h_12
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_3
  • loc_de_DE, sid_166055, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 111ms
  • REVIEWS, PRODUCT