Date published: 2026-2-4

1-800-457-3801

SCBT Portrait Logo
Seach Input

gasdermin 항체 (H-6): sc-376318

4.5(4)
리뷰 쓰기질문하기

데이터 시트
  • gasdermin 항체 H-6 는 마우스 monoclonal IgG1 κ gasdermin 항체, 9간행물에 인용, 이며 200 µg/ml으로 제공합니다.
  • human origin의 gasdermin을 항원으로 사용하였습니다.
  • gasdermin 항체 (H-6)는 WB, IP, IF and ELISA으로 mouse, rat and human유래의 gasdermin A 를 감지하는 데에 추천한다.
  • 항-gasdermin 항체(H-6)는 IP용 agarose와 결합되어 이용 가능하며, WB, IHC(P), ELISA용 HRP와 결합되어 이용 가능하며, IF, IHC(P), FCM용 phycoerythrin 또는 FITC와 결합되어 이용 가능합니다.
  • WB (RGB), IF, IHC(P) 와FCM, RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647결합제품도 있습니다.
  • WB (NIR), IF와FCM,Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 680 or Alexa Fluor® 790 결합제품도 있습니다.
  • WB, IHC(P) 와 ELISA에 사용가능한 biotin결합제품 이 있습니다.
  • 현재 gasdermin 항체(H-6)에 대해 선호하는 2차 검출 시약의 식별을 아직 완료하지 못했습니다. 이 작업은 진행 중입니다.
Crispr Promo Banner

빠른 링크

더보기

가스더민 항체(H-6)는 마우스, 쥐 및 인간 유래의 가스더민 단백질을 WB, IP, IF 및 ELISA로 검출하는 IgG1 κ 마우스 단일 클론 가스더민 항체(가스더민 항체라고도 함)입니다. 가스더민 항체(H-6)는 비접합 항-가스더민 항체 형태와 아가로스, HRP, PE, FITC 및 여러 Alexa Fluor® 접합체를 포함한 여러 접합 형태 모두로 사용할 수 있습니다. GSDMA, GSDM 또는 FKSG9로도 알려진 가스더민은 세포질의 핵 주변 영역에 국한되어 있는 445아미노산 단백질로 가스더민 계열에 속합니다. 위장관 조직에서 주로 발현되고 피부와 유선에도 존재하는 가스더민은 세포 사멸을 유도하는 기능을 하며 특히 위암 세포에서 종양 억제 작용을 하는 것으로 알려져 있습니다. 가스더민을 암호화하는 유전자는 인간 게놈의 2.5% 이상을 구성하고 1,200개 이상의 유전자를 암호화하는 인간 염색체 17번에 매핑되어 있습니다. 두 가지 주요 종양 억제 유전자는 17번 염색체와 관련이 있는데, 바로 p53과 BRCA1입니다. 종양 억제 유전자 p53은 DNA 복구와 세포 사멸을 통해 세포의 운명을 조절하여 세포의 유전적 무결성을 유지하는 데 필요합니다. p53 발현의 오작동 또는 손실은 악성 세포 성장 및 리-프라우메니 증후군과 관련이 있습니다. BRCA1은 p53과 마찬가지로 DNA 복구에 직접 관여하지만, 특히 조기 유방암과 난소, 대장, 전립선 및 나팔관 암의 유전적 결정 요인으로 인식되고 있습니다.

연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

gasdermin 항체 (H-6) 참고문헌:

  1. 생쥐 11번 염색체에 국한되는 가스더민(Gsdm)은 상부 위장관에서는 주로 발현되지만 인간 위암 세포에서는 현저히 억제됩니다.  |  Saeki, N., et al. 2000. Mamm Genome. 11: 718-24. PMID: 10967128
  2. GSDML-GSDM 유전자좌 주변의 진화적 재조합 핫스팟은 PPP1R1B-ERBB2-GRB7 앰플리콘 주변의 종양유전체 재조합 핫스팟과 밀접하게 연결되어 있습니다.  |  Katoh, M. and Katoh, M. 2004. Int J Oncol. 24: 757-63. PMID: 15010812
  3. 새로운 유전자 계열의 구성원인 Gsdm은 피부와 위장관의 상피에서만 매우 조직 특이적인 방식으로 발현됩니다.  |  Tamura, M., et al. 2007. Genomics. 89: 618-29. PMID: 17350798
  4. 위암에서 자주 억제되는 가스더민은 TGF-베타 의존성 세포 사멸 신호에서 LMO1의 표적입니다.  |  Saeki, N., et al. 2007. Oncogene. 26: 6488-98. PMID: 17471240
  5. 정상 및 악성 상부 위장관 상피에서 4개의 GSDM 계열 유전자(GSDMA-D)의 특징적인 발현과 기능.  |  Saeki, N., et al. 2009. Genes Chromosomes Cancer. 48: 261-71. PMID: 19051310
  6. 카스파제-11은 가스더민 D를 절단하여 비정통적인 인플라마좀 신호를 전달합니다.  |  Kayagaki, N., et al. 2015. Nature. 526: 666-71. PMID: 26375259
  7. 모공 형성 활성 및 가스더민 계열의 구조적 자가 억제.  |  Ding, J., et al. 2016. Nature. 535: 111-6. PMID: 27281216
  8. 파이로프토시스: 가스더민 매개 프로그램화된 괴사 세포 사멸.  |  Shi, J., et al. 2017. Trends Biochem Sci. 42: 245-254. PMID: 27932073
  9. 화학 요법 약물은 가스더민의 카스파제-3 분해를 통해 열분해를 유도합니다.  |  Wang, Y., et al. 2017. Nature. 547: 99-103. PMID: 28459430
  10. 가스더민 D 모공 형성 활성의 분자 메커니즘.  |  Devant, P. and Kagan, JC. 2023. Nat Immunol. 24: 1064-1075. PMID: 37277654
  11. 가스더민 및 MLKL 괴사 세포 사멸 효과 인자: 신호와 질병.  |  Lawlor, KE., et al. 2024. Immunity. 57: 429-445. PMID: 38479360
  12. 상피 내 비만 세포는 가스더민 C 매개 2형 면역을 유도합니다.  |  Yang, L., et al. 2024. Immunity. 57: 1056-1070.e5. PMID: 38614091

주문정보

제품명카탈로그 번호 단위가격수량관심품목

gasdermin 항체 (H-6)

sc-376318
200 µg/ml
RMB2422.00

gasdermin 항체 (H-6) AC

sc-376318 AC
500 µg/ml, 25% agarose
RMB3189.00

gasdermin 항체 (H-6) HRP

sc-376318 HRP
200 µg/ml
RMB2422.00

gasdermin 항체 (H-6) FITC

sc-376318 FITC
200 µg/ml
RMB2527.00

gasdermin 항체 (H-6) PE

sc-376318 PE
200 µg/ml
RMB2625.00

gasdermin 항체 (H-6) Alexa Fluor® 488

sc-376318 AF488
200 µg/ml
RMB2738.00

gasdermin 항체 (H-6) Alexa Fluor® 546

sc-376318 AF546
200 µg/ml
RMB2738.00

gasdermin 항체 (H-6) Alexa Fluor® 594

sc-376318 AF594
200 µg/ml
RMB2738.00

gasdermin 항체 (H-6) Alexa Fluor® 647

sc-376318 AF647
200 µg/ml
RMB2738.00

gasdermin 항체 (H-6) Alexa Fluor® 680

sc-376318 AF680
200 µg/ml
RMB2738.00

gasdermin 항체 (H-6) Alexa Fluor® 790

sc-376318 AF790
200 µg/ml
RMB2738.00

gasdermin 항체 (H-6) B

sc-376318 B
200 µg/ml
RMB2452.00

Necesito el anticuerpo para usarlo en Inmunohistquimica. Tiene disponible el anticuerpo para esa técnica?

Asked by: Anonymous
Deberá ponerse en contacto con su distribuidor local. A continuación se muestra un enlace a su información de contacto. https://www.scbt.com/resources/distributors
Answered by: Technical Service
Date published: 2024-10-11

Is the gasdermin Antibody (H-6) recommended with m-IgG Fc BP-HRP, m-IgG1 BP-HRP or m-IgGκ BP-HRP by any chance?

Asked by: Fern
Thank you for your question. At present, we have not yet completed the identification of the preferred secondary detection reagent(s) for gasdermin Antibody (H-6). This work is in progress.
Answered by: BlakeJ
Date published: 2024-07-22

For western blots, should I dilute the primary antibody in 5% w/v nonfat dry milk, 1X TBS, 0.1% Tween® 20 or just T-TBS? Thank you

Asked by: tonytony
Thank you for your question. For blocking we recommend UltraCruz® Blocking Reagent: sc-516214. Otherwise, milk-based blocking buffers are best suited for a broad blocking effect reducing unspecific signals, or BSA-based blocking if signals are specific but comparatively faint. Contact our technical service team directly for further assistance.
Answered by: Tech Support Europe
Date published: 2023-06-14

Does the antibody recognize cleaved form of GSDMD? Such as N-term (p30) and C-term (p23)? Thanks!

Asked by: tuuu
Thank you for the question. Gasdermin is a 445 amino acid protein This clone (H-6) was raised against amino acids 1-196 mapping at the N-terminus of human Gasdermin. Epitope mapping has not been carried out for this antibody. Therefore the exact binding region within the below sequence and reactivity with cleaved GSDMDs has not been determined, yet: MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSPSDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETVQERKLAADHPFLKEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVT
Answered by: Technical Support Europe
Date published: 2017-12-27

What is the recommended fixation method for immunofluorescence staining with gasdermin (H-6): sc-376318 monoclonal antibody?

Asked by: Germaine
Thank you for your inquiry. We recommend fixing cells for 5 minutes in -10°C methanol and allowing to air dry. The full protocol can be viewed here: https://www.scbt.com/scbt/resources/protocols/immunofluorescence-cell-staining
Answered by: Technical Support
Date published: 2017-02-24
  • y_2026, m_2, d_3, h_5CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_5
  • loc_ko_KR, sid_376318, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 152ms
  • QUESTIONS, PRODUCT
Rated 3 out of 5 by from GasderminNice antibody-Gasdermin H-6 detects 53kd band with the mouse liver lysate-1:400 dil in 5% SM.
Date published: 2017-05-19
Rated 5 out of 5 by from This is the recommended gasdermin monoclonalWorks as expected in Western blotting and Immunofluoresence on mouse, rat an human samples
Date published: 2017-02-01
Rated 5 out of 5 by from Produced excellent immunofluorescence cytoplasmicProduced excellent immunofluorescence cytoplasmic staining in methanol-fixed HeLa cells. -SCBT QC
Date published: 2015-05-01
Rated 5 out of 5 by from Produced positive Western Blot data of gasderminProduced positive Western Blot data of gasdermin expression in non-transfected and mouse gasdermin transfected 293 whole cell lysates. -SCBT QC
Date published: 2013-09-11
  • y_2026, m_2, d_3, h_5
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_4
  • loc_ko_KR, sid_376318, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT
gasdermin 항체 (H-6) is rated 4.5 out of 5 by 4.
  • y_2026, m_2, d_3, h_5
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_4
  • loc_ko_KR, sid_376318, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 130ms
  • REVIEWS, PRODUCT