Date published: 2025-9-11

001 800-1338-3838

SCBT Portrait Logo
Seach Input

VIP 항체 (H-6): sc-25347

4.9(11)
리뷰 쓰기질문하기

데이터 시트
  • VIP 항체 H-6 는 마우스 monoclonal IgG2b κ VIP 항체, 38간행물에 인용, 이며 200 µg/ml으로 제공합니다.
  • human origin의 vasoactive intestinal peptide (VIP)에서 내부에 위치한 1-95 아미노산을 항원으로 사용하였습니다.
  • VIP 항체 (H-6)는 WB, IP, IF, IHC(P) and ELISA으로 human유래의 VIP 를 감지하는 데에 추천한다 .
  • Anti-VIP Antibody (H-6) is available conjugated to agarose for IP; HRP for WB, IHC(P) and ELISA; and to either phycoerythrin or FITC for IF, IHC(P) and FCM
  • WB (RGB), IF, IHC(P) 와FCM, RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647결합제품도 있습니다.
  • WB (NIR), IF와FCM,Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 680 or Alexa Fluor® 790 결합제품도 있습니다.
  • VIP (H-6): sc-25347무료10 µg 샘플을 신청하려면 기술지원팀 (또는 로컬 디스트리뷰터)에 연락주세요.
  • m-IgG2b BP-HRPm-IgGκ BP-HRP 는 VIP 항체 (H-6) 가 WB and IHC(P) 에 응용될 때 우선으로 사용하는 이차 항체 검사 시약입니다.이 시약은VIP 항체(H-6) 와 세트로 제공드립니다. (아래의 주문 정보를 참고해 주시길 바랍니다).

빠른 링크

더보기

VIP 항체 (H-6)는 WB, IP, IF, IHC(P) 및 ELISA에 의해 인간 기원의 VIP 단백질을 검출하는 IgG2b κ 마우스 단일 클론 VIP 항체 (혈관 확장 유도) 패밀리 구성원 항체, 혈관 활성 장 폴리펩티드 (VIP) 항체, 28 아미노산 글루카곤/세크레틴 슈퍼 패밀리 리간드 항체, G 단백질-coupled 수용체 (GPCR) VPAC1 / VPAC2 리간드 항체 또는 PHM27 항체)이다. VIP 항체 (H-6)는 비 conjug 결합 항-VIP 항체 형태뿐만 아니라 아가로스, HRP, PE, FITC 및 다중 Alexa Fluor® 결합체를 포함한 다중 결합 형태의 항-VIP 항체로 사용할 수 있다. 글루카곤은 인슐린에 대한 길항제 역할을 하여 글리코겐의 포도당 전환을 자극하고 혈당 수치를 증가시키는 췌장 호르몬이다. 글루카곤 유사 펩티드-1 (GLP-1), 글루카곤 유사 펩티드-2 (GLP-2), VIP (혈관 활성 장 펩티드) 및 PACAP (뇌하수체 아데닐산 사이클라제 활성화 폴리펩티드)는 글루카곤 호르몬군의 구성원이다. GLP-1은 중추신경계에서 전송기 역할을 하여 섭식 및 음주 행동을 억제하는 반면, GLP-2는 장 상피 성장의 자극제이다. VIP는 혈관 확장을 일으켜 혈압을 낮춥니다. PACAP는 시상하부에 풍부하며 성장 호르몬을 포함한 여러 호르몬의 합성을 증가시키는 것으로 나타났습니다.

연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

VIP 항체 (H-6) 참고문헌:

  1. 서브틸리신 유사 프로호르몬에 의한 프로글루카곤의 차등 처리는 PC2와 PC3를 변환하여 글루카곤 또는 글루카곤 유사 펩타이드를 생성합니다.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. 쥐 췌장 섬 세포에서 글루카곤, 글루카곤 유사 펩타이드 I 및 포도당 의존성 인슐린 이완 펩타이드 수용체의 발현 및 기능적 활성.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. 글루카곤 유사 펩타이드 1 수용체 유전자에 돌연변이가 없는 생쥐에서 포도당 과민증은 있지만 포만감은 정상입니다.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. 혈관 활성 장 펩타이드(VIP)는 VIP-1 수용체를 보유한 인간 췌장 선암종 유래 세포의 시험관 내 성장을 자극합니다.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. 간에서 글리코겐 대사의 특정 특징.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. 뇌하수체 아데닐레이트 사이클라제 활성화 폴리펩타이드(PACAP) 38과 PACAP27은 공통적이고 뚜렷한 세포 내 신호 경로를 활성화하여 돼지 소마토트로피에서 성장 호르몬 분비를 자극합니다.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

주문정보

제품명카탈로그 번호 단위가격수량관심품목

VIP 항체 (H-6)

sc-25347
200 µg/ml
RMB2377.00

VIP (H-6): m-IgGκ BP-HRP 번들

sc-520782
200 µg Ab, 40 µg BP
RMB2662.00

VIP (H-6): m-IgG2b BP-HRP 번들

sc-548853
200 µg Ab; 10 µg BP
RMB2662.00

VIP 항체 (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
RMB3129.00

VIP 항체 (H-6) HRP

sc-25347 HRP
200 µg/ml
RMB2377.00

VIP 항체 (H-6) FITC

sc-25347 FITC
200 µg/ml
RMB2482.00

VIP 항체 (H-6) PE

sc-25347 PE
200 µg/ml
RMB2580.00

VIP 항체 (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
RMB2685.00

VIP 항체 (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
RMB2685.00

VIP 항체 (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
RMB2685.00

VIP 항체 (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
RMB2685.00

VIP 항체 (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
RMB2685.00

VIP 항체 (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
RMB2685.00

Hi, does this antibody work with IHC on free floating sections from mouse?

Asked by: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email [email protected].
Answered by: BlakeJ
Date published: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Asked by: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Answered by: Tech Support Europe
Date published: 2021-09-13

Did you test this antibody in flowcytometry ?

Asked by: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Answered by: Tech Service
Date published: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Asked by: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Answered by: Tech Service
Date published: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Asked by: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Answered by: Technical Support
Date published: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Asked by: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Answered by: SCBT Heidelberg Support
Date published: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Asked by: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Answered by: Technical Support Europe
Date published: 2018-01-10

Can VIP (H-6): sc-25347 monoclonal antibody be used for double or triple staining, if the other primary antibodies are also raised in mouse?

Asked by: cjMara
In this case, we recommend using a directly conjugated mouse monoclonal primary antibody. VIP (H-6): sc-25347 monoclonal antibody is currently available conjugated to PE, FITC, Alexa Fluor 488, and Alexa Fluor 647.
Answered by: Technical Support 15
Date published: 2017-01-22
  • y_2025, m_9, d_11, h_4CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_8
  • loc_ko_KR, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 105ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Date published: 2024-11-07
Rated 5 out of 5 by from Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Date published: 2023-02-02
Rated 5 out of 5 by from It looked greatI ordered this a month ago and it worked great! I will purchase again
Date published: 2018-05-04
Rated 5 out of 5 by from Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Date published: 2018-01-31
Rated 5 out of 5 by from GoodThe analysis results of WB were very stong and clear, it worked well for WB
Date published: 2017-06-08
Rated 5 out of 5 by from Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Date published: 2017-01-11
Rated 4 out of 5 by from Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Date published: 2015-07-08
Rated 5 out of 5 by from Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Date published: 2015-06-02
  • y_2025, m_9, d_11, h_4
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_ko_KR, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT
VIP 항체 (H-6) is rated 4.9 out of 5 by 11.
  • y_2025, m_9, d_11, h_4
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_ko_KR, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 113ms
  • REVIEWS, PRODUCT