Date published: 2026-3-28

1-800-457-3801

SCBT Portrait Logo
Seach Input

VIP 항체 (H-6): sc-25347

4.9(11)
리뷰 쓰기질문하기

데이터 시트
  • VIP 항체 H-6 는 마우스 monoclonal IgG2b κ VIP 항체, 38간행물에 인용, 이며 200 µg/ml으로 제공합니다.
  • human origin의 vasoactive intestinal peptide (VIP)에서 내부에 위치한 1-95 아미노산을 항원으로 사용하였습니다.
  • VIP 항체 (H-6)는 WB, IP, IF, IHC(P) and ELISA으로 human유래의 VIP 를 감지하는 데에 추천한다 .
  • 항-VIP 항체(H-6)는 IP용 agarose와 결합되어 이용 가능하며, WB, IHC(P), ELISA용 HRP와 결합되어 이용 가능하며, IF, IHC(P), FCM용 phycoerythrin 또는 FITC와 결합되어 이용 가능합니다.
  • WB (RGB), IF, IHC(P) 와FCM, RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647결합제품도 있습니다.
  • WB (NIR), IF와FCM,Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 680 or Alexa Fluor® 790 결합제품도 있습니다.
  • 2b BP-HRP">m-IgG2b BP-HRPm-IgGκ BP-HRP는 VIP 항체 (H-6) WB 및 IHC(P) 애플리케이션용입니다. 이 시약은 이제 VIP 항체 (H-6)와 함께 번들로 제공됩니다(아래 주문 정보 참조).
Crispr Promo Banner

빠른 링크

더보기

VIP 항체(H-6)는 인간 혈관활성 장펩티드(VIP)를 검출하도록 설계된 쥐 단일클론 IgG2b 카파 경쇄 항체로서, PHM27 또는 글루카곤 계열의 일종으로도 알려져 있습니다. VIP 단일 클론 항체(H-6)는 VIP 단백질의 1-95번 아미노산에 대해 생성되어 웨스턴 블랏팅(WB), 면역침전법(IP), 면역형광법(IF), 파라핀 포매 절편을 이용한 면역조직화학(IHCP), 효소결합 면역흡착 분석법(ELISA) 등 다양한 실험 기법 전반에 걸쳐 정확한 결합과 높은 친화성을 보장합니다. 혈관활성 장 펩티드는 평활근 이완과 혈관 확장에 중요한 역할을 담당함으로써 혈압을 조절하고 장의 수분과 전해질 분비를 촉진하는 역할을 담당하기 때문에, 심혈관 및 위장 연구에서 그 중요성이 강조되고 있습니다. VIP는 혈관 확장 효과 외에도 신경 보호, 면역 체계 조절에 필수적이며 항염증 특성을 나타내므로, VIP(H-6) 항체는 다양한 생리학적 과정과 잠재적 치료 응용 분야에서 핵심적인 도구로 사용되고 있습니다. VIP 단일클론 항체(H-6)는 비접합 형태와 말차 추출물 과산화효소(HRP), 피코에리틴(PE), 플루오레세인 이소티오시아네이트(FITC), 다양한 알렉사 플루오르 염료 등을 포함한 다중 접합 형태로 제공되어 다양한 실험 설정에 유연성을 제공합니다. 항-VIP 항체(H-6)를 사용하면 과학자들이 VIP와 관련된 메커니즘을 효과적으로 연구하고 혈관 확장, 면역 조절, 염증 반응과 관련된 질환에 대한 잠재적 치료 표적을 확인할 수 있습니다.

연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

VIP 항체 (H-6) 참고문헌:

  1. 서브틸리신 유사 프로호르몬에 의한 프로글루카곤의 차등 처리는 PC2와 PC3를 변환하여 글루카곤 또는 글루카곤 유사 펩타이드를 생성합니다.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. 쥐 췌장 섬 세포에서 글루카곤, 글루카곤 유사 펩타이드 I 및 포도당 의존성 인슐린 이완 펩타이드 수용체의 발현 및 기능적 활성.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. 글루카곤 유사 펩타이드 1 수용체 유전자에 돌연변이가 없는 생쥐에서 포도당 과민증은 있지만 포만감은 정상입니다.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. 혈관 활성 장 펩타이드(VIP)는 VIP-1 수용체를 보유한 인간 췌장 선암종 유래 세포의 시험관 내 성장을 자극합니다.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. 간에서 글리코겐 대사의 특정 특징.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. 뇌하수체 아데닐레이트 사이클라제 활성화 폴리펩타이드(PACAP) 38과 PACAP27은 공통적이고 뚜렷한 세포 내 신호 경로를 활성화하여 돼지 소마토트로피에서 성장 호르몬 분비를 자극합니다.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

주문정보

제품명카탈로그 번호 단위가격수량관심품목

VIP 항체 (H-6)

sc-25347
200 µg/ml
$322.00

VIP (H-6): m-IgGκ BP-HRP 번들

sc-520782
200 µg Ab, 40 µg BP
$361.00

VIP (H-6): m-IgG2b BP-HRP 번들

sc-548853
200 µg Ab; 10 µg BP
$361.00

VIP 항체 (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
$424.00

VIP 항체 (H-6) HRP

sc-25347 HRP
200 µg/ml
$322.00

VIP 항체 (H-6) FITC

sc-25347 FITC
200 µg/ml
$336.00

VIP 항체 (H-6) PE

sc-25347 PE
200 µg/ml
$349.00

VIP 항체 (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
$364.00

VIP 항체 (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
$364.00

VIP 항체 (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
$364.00

VIP 항체 (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
$364.00

VIP 항체 (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
$364.00

VIP 항체 (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
$364.00

Can you take a picture of the product‘s package? Can' t find it after cleaning the lab...

Asked by: Anonymous
Thank you for your question. Please contact our Technical Service Department. Our Asian Technical Service team is available at (+86) 021-60936350 or [email protected] or by live chat on our website.
Answered by: Sen Li
Date published: 2026-01-30

Hi, does this antibody work with IHC on free floating sections from mouse?

Asked by: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email [email protected].
Answered by: BlakeJ
Date published: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Asked by: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Answered by: Tech Support Europe
Date published: 2021-09-13

Did you test this antibody in flowcytometry ?

Asked by: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Answered by: Tech Service
Date published: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Asked by: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Answered by: Tech Service
Date published: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Asked by: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Answered by: Technical Support
Date published: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Asked by: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Answered by: SCBT Heidelberg Support
Date published: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Asked by: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Answered by: Technical Support Europe
Date published: 2018-01-10
  • y_2026, m_3, d_27, h_8CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_9
  • loc_ko_KR, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 112ms
  • QUESTIONS, PRODUCT
Rated 5 out of 5 by from Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Date published: 2024-11-07
Rated 5 out of 5 by from Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Date published: 2023-02-02
Rated 5 out of 5 by from It looked greatI ordered this a month ago and it worked great! I will purchase again
Date published: 2018-05-04
Rated 5 out of 5 by from Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Date published: 2018-01-31
Rated 5 out of 5 by from GoodThe analysis results of WB were very stong and clear, it worked well for WB
Date published: 2017-06-08
Rated 5 out of 5 by from Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Date published: 2017-01-11
Rated 4 out of 5 by from Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Date published: 2015-07-08
Rated 5 out of 5 by from Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Date published: 2015-06-02
  • y_2026, m_3, d_27, h_8
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_ko_KR, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 10ms
  • REVIEWS, PRODUCT
VIP 항체 (H-6) is rated 4.9 out of 5 by 11.
  • y_2026, m_3, d_27, h_8
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_ko_KR, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 87ms
  • REVIEWS, PRODUCT