Date published: 2025-9-16

00800 4573 8000

SCBT Portrait Logo
Seach Input

Anticorps secretin receptor (E-9): sc-166112

3.5(4)
Écrire une critiquePoser une question

Fiches techniques
  • L'anticorps secretin receptor E-9 est un monoclonal IgG1 (chaîne légère kappa) L'Anticorps secretin receptor fourni en 200 µg/ml
  • soulevée à l'encontre des acides aminés 33-121 correspondant à C-terminus de secretin d'origine human.
  • L'Anticorps secretin receptor (E-9) est recommandé pour la détection de secretin precursor and active peptide d'origine human par WB, IP, IF et ELISA
  • Anti-L'Anticorps secretin receptor (E-9) est disponible conjugué à l'agarose pour IP; à l'HRP pour WB, IHC(P) et ELISA; et soit à la phycoerythrin ou FITC pour IF, IHC(P) et FCM
  • aussi disponible conjugué à l'Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 ou Alexa Fluor® 647 pour WB (RGB), IF, IHC(P) et FCM
  • aussi disponible conjugué à l'Alexa Fluor® 680 ou Alexa Fluor® 790 pour WB (NIR), IF et FCM
  • Contactez notre Service Technique (ou votre Distributeur local) pour plus d'informations pour recevoir un échantillon GRATUIT de 10 µg de secretin receptor (E-9): sc-166112.
  • m-IgG Fc BP-HRP et 1 BP-HRP">m-IgG1 BP-HRP sont les réactifs de détection secondaire préférés pour secretin receptor Antibody (E-9) for WB applications. Ces réactifs sont désormais proposés en lots avec secretin receptor Antibody (E-9)(voir les informations de commande ci-dessous).

    ACCÈS RAPIDE AUX LIENS

    VOIR ÉGALEMENT...

    L'anticorps anti-récepteur de la sécrétine (E-9) est un anticorps monoclonal IgG1 κ de souris anti-récepteur de la sécrétine (également désigné comme anticorps anti-récepteur de la sécrétine) qui détecte la protéine du récepteur de la sécrétine d'origine humaine par WB, IP, IF et ELISA. L'anticorps anti-récepteur de la sécrétine (E-9) est disponible sous forme d'anticorps anti-récepteur de la sécrétine non conjugué, ainsi que sous plusieurs formes conjuguées d'anticorps anti-récepteur de la sécrétine, y compris agarose, HRP, PE, FITC et plusieurs conjugués Alexa Fluor®. La sécrétine est une hormone de 27 acides aminés produite par des cellules endocrines spécifiques, les cellules S, situées dans la muqueuse de l'intestin grêle proximal. La sécrétine est connue pour être un puissant stimulant de la sécrétion du suc pancréatique riche en bicarbonate. La sécrétion de sécrétine est stimulée par la présence d'un pH acide ou d'acides gras dans le duodénum. La sécrétine est synthétisée sous la forme d'un précurseur plus important. La séquence d'acides aminés déduite comprend un peptide signal, un peptide amino-terminal, la sécrétine elle-même et un peptide carboxy-terminal de 72 acides aminés. La sécrétine stimule la sécrétion biliaire canalaire en interagissant directement avec les cholangiocytes. Elle stimule l'exocytose dans les cholangiocytes, qui transportent l'eau principalement par le canal aquaporine-1. Le déficit en sécrétine pourrait être impliqué dans le syndrome autistique, suggérant que l'hormone pourrait avoir une fonction neuroendocrine en plus de son rôle dans la digestion. Le gène codant pour la sécrétine est localisé sur le chromosome humain 11p15.5.

    Pour la Recherche Uniquement. Non destiné à un usage diagnostique ou thérapeutique.

    Alexa Fluor® est une marque déposée de Molecular Probes Inc., OR., USA

    LI-COR® et Odyssey® sont marques déposées de LI-COR Biosciences

    Anticorps secretin receptor (E-9) Références:

    1. Sécrétine humaine (SCT): structure du gène, localisation chromosomique et distribution de l'ARNm.  |  Whitmore, TE., et al. 2000. Cytogenet Cell Genet. 90: 47-52. PMID: 11060443
    2. Le mécanisme de la sécrétion pancréatique.  |  Bayliss, WM. and Starling, EH. 1902. J Physiol. 28: 325-53. PMID: 16992627
    3. Sécrétine: structure du précurseur et distribution tissulaire de l'ARNm.  |  Kopin, AS., et al. 1990. Proc Natl Acad Sci U S A. 87: 2299-303. PMID: 2315322
    4. Structure de la sécrétine porcine. Séquence d'acides aminés.  |  Mutt, V., et al. 1970. Eur J Biochem. 15: 513-9. PMID: 5465996
    5. La sécrétine favorise le transport osmotique de l'eau dans les cholangiocytes de rat en augmentant les canaux d'eau aquaporin-1 dans la membrane plasmique. Preuve d'une translocation vésiculaire de l'aquaporine-1 induite par la sécrétine.  |  Marinelli, RA., et al. 1997. J Biol Chem. 272: 12984-8. PMID: 9148905

    Informations pour la commande

    Nom du produitRef. CatalogueCOND.Prix HTQTÉFavoris

    Anticorps secretin receptor (E-9)

    sc-166112
    200 µg/ml
    RMB2377.00

    secretin receptor (E-9): m-IgG Fc BP-HRP Kit

    sc-527138
    200 µg Ab; 10 µg BP
    RMB2662.00

    secretin receptor (E-9): m-IgG1 BP-HRP Kit

    sc-532511
    200 µg Ab; 20 µg BP
    RMB2662.00

    Anticorps secretin receptor (E-9) AC

    sc-166112 AC
    500 µg/ml, 25% agarose
    RMB3129.00

    Anticorps secretin receptor (E-9) HRP

    sc-166112 HRP
    200 µg/ml
    RMB2377.00

    Anticorps secretin receptor (E-9) FITC

    sc-166112 FITC
    200 µg/ml
    RMB2482.00

    Anticorps secretin receptor (E-9) PE

    sc-166112 PE
    200 µg/ml
    RMB2580.00

    Anticorps secretin receptor (E-9) Alexa Fluor® 488

    sc-166112 AF488
    200 µg/ml
    RMB2685.00

    Anticorps secretin receptor (E-9) Alexa Fluor® 546

    sc-166112 AF546
    200 µg/ml
    RMB2685.00

    Anticorps secretin receptor (E-9) Alexa Fluor® 594

    sc-166112 AF594
    200 µg/ml
    RMB2685.00

    Anticorps secretin receptor (E-9) Alexa Fluor® 647

    sc-166112 AF647
    200 µg/ml
    RMB2685.00

    Anticorps secretin receptor (E-9) Alexa Fluor® 680

    sc-166112 AF680
    200 µg/ml
    RMB2685.00

    Anticorps secretin receptor (E-9) Alexa Fluor® 790

    sc-166112 AF790
    200 µg/ml
    RMB2685.00

    The data sheet says this antibody was raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin. Secretin receptor (P47872) is a 440 aa protein. Where is the epitope? At the N-terminus?

    Posée par: akira
    Thank you for your question. secretin receptor (E-9) is a mouse monoclonal antibody raised against amino acids 33-121 mapping at the C-terminus of secretin of human origin.The epitope is DVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNL Thank you.
    Répondue par: Jiajun Z
    Date de publication: 2022-12-26

    Is is directed against the receptor or secretin itself? The datasheet does not give clear answers.

    Posée par: Loudi
    Thank you for your question. Anti-secretin receptor Antibody (E-9): sc-166112 recognizes secretin receptor, with protein accession number P47872.
    Répondue par: Tech Support Europe
    Date de publication: 2021-09-23

    Is there any secretin antibody available specific for mouse/rat.If available can we inject this antibody by intra peritoneally/i.v./ in vivo in animal to check its binding to secretin receptor in vivo?

    Posée par: vijay modak
    Thank you for your question. At this time we have not validated any of our secretin receptor antibodies for reactivity with mouse or rat. We do not support any of our products for use in vivo or in live animal studies.
    Répondue par: Technical Service
    Date de publication: 2017-04-24

    For Western Blot, is it recommended to use denatured or non-denatured conditions with secretin receptor (E-9): sc-166112 monoclonal antibody?

    Posée par: jenniferc
    Thank you for your question. We recommend this antibody for use in denatured Western Blot conditions. It has not been validated for use in non-denatured conditions. Please contact our Technical Service Department for further details or inquiries.
    Répondue par: Technical Support
    Date de publication: 2017-02-27
    • y_2025, m_9, d_16, h_9CST
    • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasquestionsanswers, tq_4
    • loc_fr_FR, sid_166112, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getContent, 109ms
    • QUESTIONS, PRODUCT
    Rated 1 de 5 de par Doesn't recognize the secretin receptorThis antibody does not recognize secretin receptor should be all ubiquitous in the gut villi epithelium but perhaps recognizes secretin.
    Date de publication: 2021-04-09
    Rated 4 de 5 de par Good antibodyWorks as we expected. Tested by immunofluorescence.
    Date de publication: 2018-12-18
    Rated 4 de 5 de par This antibody worksIn a western blot, the antibody worked well and thus we recommend it to others.
    Date de publication: 2018-01-19
    Rated 5 de 5 de par Produced positive Western blot data of truncatedProduced positive Western blot data of truncated human recombinant secretin fusion protein. -SCBT QC
    Date de publication: 2014-05-08
    • y_2025, m_9, d_16, h_9
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_fr_FR, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getReviews, 15ms
    • REVIEWS, PRODUCT
    Anticorps secretin receptor (E-9) est évalué 3.5 de 5 de 4.
    • y_2025, m_9, d_16, h_9
    • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
    • cp_1, bvpage1
    • co_hasreviews, tv_0, tr_4
    • loc_fr_FR, sid_166112, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
    • clientName_scbt
    • bvseo_sdk, java_sdk, bvseo-4.0.0
    • CLOUD, getAggregateRating, 114ms
    • REVIEWS, PRODUCT