Date published: 2025-9-11

001 800-1338-3838

SCBT Portrait Logo
Seach Input

SBP Tag 항체 (SB19-C4): sc-101595

4.4(10)
리뷰 쓰기질문하기

데이터 시트
  • SBP Tag 항체 SB19-C4 는 마우스 monoclonal IgG1 κ SBP Tag 항체, 58간행물에 인용, 이며 200 µg/ml으로 제공합니다.
  • HSV-1의 tsLB2 돌연변이에 대해 양성 반응
  • SBP Tag 항체(SB19-C4)는 WB and IF으로 SBP tag 를 감지하는 데에 추천한다 .
  • SBP Tag 항체(SB19-C4)는 IP용으로 agarose에 결합된 형태로 제공됩니다. 그리고 IF, IHC(P) 및 FCM용으로 phycoerythrin 또는 FITC에 결합된 형태로 제공됩니다.
  • WB (RGB), IF, IHC(P) 와FCM, RGB fluorescent imaging systems, such as iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 or Alexa Fluor® 647결합제품도 있습니다.
  • WB (NIR), IF와FCM,Near-Infrared (NIR) detection systems, such as LI-COR®Odyssey®, iBright™ FL1000, FluorChem™, Typhoon, Azure and other comparable systems에 사용가능한 Alexa Fluor® 680 or Alexa Fluor® 790 결합제품도 있습니다.
  • SBP Tag (SB19-C4): sc-101595무료10 µg 샘플을 신청하려면 기술지원팀 (또는 로컬 디스트리뷰터)에 연락주세요.
  • 현재 SBP Tag 항체(SB19-C4)에 대해 선호하는 2차 검출 시약의 식별을 아직 완료하지 못했습니다. 이 작업은 진행 중입니다.

빠른 링크

더보기

SBP 태그 항체(SB19-C4)는 SBP 태그 단백질을 WB 및 IF로 검출하는 IgG1 κ 마우스 단일 클론 SBP 태그 항체(스트렙타비딘 결합 펩티드 항체, SBP-Tag 항체, 38 아미노산 SBP 태그 항체, SBP 항체 또는 MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP 항체로도 지정됨)입니다. SBP 태그 항체(SB19-C4)는 비접합 항체 형태와 아가로스, PE, FITC 및 여러 Alexa Fluor® 접합체를 포함한 여러 접합 형태의 항체 항체 형태로 제공됩니다. 스트렙토마이세스 아비디니에서 정제된 사면체 단백질인 스트렙타비딘은 비오틴과 10-14몰/l의 Kd로 매우 단단히 결합하여 알려진 가장 강력한 생물학적 및 비공유적 상호작용 중 하나를 형성합니다. 스트렙타비딘의 각 모노머는 비오틴 한 분자와 결합합니다. 스트렙타비딘-바이오틴의 강력한 결합은 다양한 화학 물질을 표면에 "접착"하고 방사성 동위 원소 및 단일 클론 항체와 같은 분자를 서로 연결하는 데 사용할 수 있습니다. 스트렙타비딘은 과학 실험실에서 일반적으로 면역화학 정제에 널리 활용되며, 진단 및 실험실 키트에서 가장 중요한 구성 요소 중 하나입니다. SBP 태그(스트렙타비딘 결합 단백질 태그)는 스트렙타비딘에 결합하는 38개 아미노산 단백질 친화성 서열로, 다양한 재조합 단백질의 검출 및 정제에 사용할 수 있습니다.

연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

SBP Tag 항체 (SB19-C4) 참고문헌:

  1. 나노몰 친화성 스트렙타비딘 결합 펩타이드인 SBP-Tag를 사용한 재조합 단백질의 원스텝 정제.  |  Keefe, AD., et al. 2001. Protein Expr Purif. 23: 440-6. PMID: 11722181
  2. 단백질 간의 리간드 교환. 아비딘과 스트렙타비딘 사이의 비오틴 및 비오틴 유도체 교환.  |  Pazy, Y., et al. 2002. J Biol Chem. 277: 30892-900. PMID: 12055191
  3. 베네수엘라 말 뇌염 바이러스에 대한 스트렙타비딘 결합 펩타이드 태그 단일 사슬 가변 단편 항체의 유전 공학.  |  Hu, WG., et al. 2002. Hybrid Hybridomics. 21: 415-20. PMID: 12573105
  4. 재조합 단백질의 정제 및 검출을 위한 스트렙타비딘 결합 펩타이드인 나노 태그입니다.  |  Lamla, T. and Erdmann, VA. 2004. Protein Expr Purif. 33: 39-47. PMID: 14680960
  5. 스트렙타비딘의 재조합 발현에 유리한 용해도 파트너.  |  Sørensen, HP., et al. 2003. Protein Expr Purif. 32: 252-9. PMID: 14965771
  6. 스트렙타비딘-바이오틴 시스템에서의 협력적 수소 결합 상호 작용.  |  Hyre, DE., et al. 2006. Protein Sci. 15: 459-67. PMID: 16452627
  7. 단일 펨토몰 비오틴 결합 부위를 가진 1가 스트렙타비딘.  |  Howarth, M., et al. 2006. Nat Methods. 3: 267-73. PMID: 16554831
  8. 스트렙타비딘에 결합된 (+)-에피-비오틴의 고해상도 구조.  |  Le Trong, I., et al. 2006. Acta Crystallogr D Biol Crystallogr. 62: 576-81. PMID: 16699183
  9. 스트렙타비딘-아가로스 풀다운에 의한 단백질-DNA 결합 분석.  |  Wu, KK. 2006. Methods Mol Biol. 338: 281-90. PMID: 16888365
  10. 스트렙타비딘 결합 펩티드(SBP) 태그를 부착한 SMC2는 콘덴신 복합체의 단일 단계 친화성 형광, 블로팅 또는 정제를 가능하게 합니다.  |  Kim, JH., et al. 2010. BMC Biochem. 11: 50. PMID: 21194474
  11. 스트렙타비딘 결합 펩타이드 태그 단백질 또는 비오틴화 단백질을 정제하기 위한 재사용성을 갖춘 구조 유도적 엔지니어링 스트렙타비딘 설계.  |  Wu, SC. and Wong, SL. 2013. PLoS One. 8: e69530. PMID: 23874971
  12. 스트렙타비딘 결합 펩타이드(SBP) 태그를 사용한 ERK 신호 복합체의 단일 단계 친화성 정제.  |  Yang, L. and Veraksa, A. 2017. Methods Mol Biol. 1487: 113-126. PMID: 27924562

주문정보

제품명카탈로그 번호 단위가격수량관심품목

SBP Tag 항체 (SB19-C4)

sc-101595
200 µg/ml
RMB2377.00

SBP Tag 항체 (SB19-C4) AC

sc-101595 AC
500 µg/ml, 25% agarose
RMB3129.00

SBP Tag 항체 (SB19-C4) FITC

sc-101595 FITC
200 µg/ml
RMB2482.00

SBP Tag 항체 (SB19-C4) PE

sc-101595 PE
200 µg/ml
RMB2580.00

SBP Tag 항체 (SB19-C4) Alexa Fluor® 488

sc-101595 AF488
200 µg/ml
RMB2685.00

SBP Tag 항체 (SB19-C4) Alexa Fluor® 546

sc-101595 AF546
200 µg/ml
RMB2685.00

SBP Tag 항체 (SB19-C4) Alexa Fluor® 594

sc-101595 AF594
200 µg/ml
RMB2685.00

SBP Tag 항체 (SB19-C4) Alexa Fluor® 647

sc-101595 AF647
200 µg/ml
RMB2685.00

SBP Tag 항체 (SB19-C4) Alexa Fluor® 680

sc-101595 AF680
200 µg/ml
RMB2685.00

SBP Tag 항체 (SB19-C4) Alexa Fluor® 790

sc-101595 AF790
200 µg/ml
RMB2685.00

I am looking for an antibody that recognizes the SBP tag and can be used for immunoprecipitation (ChIP). Will this antibody work? If not, could you point me to one that will?

Asked by: MTStan
Thank you for your question. This antibody has not yet been tested for IP or ChIP applications. We are aware of a couple of product citations using this antibody for IP (PMID's: 2402161 and 25412508), but nothing yet for ChIP. The agarose conjugated antibody is recommended and warrantied for immunoprecipitation (IP), however we are still gathering data to show on our website. Check back for updates!
Answered by: Technical Support
Date published: 2020-02-06

I have (sc-101595) SBP Tag-HRP ab. What is the dilution you recommend for ELISA? Thanks,

Asked by: yangm6
Thank you for your question. We do not have established dilutions for ELISA for our antibodies as they require titration. You can find our ELISA protocol on the website here: https://www.scbt.com/scbt/resources/protocols/elisa-assays
Answered by: Technical Service
Date published: 2017-07-14

I have run out of the goat anti-mouse secondary antibody I usually use for WB detection. What do you recommend I use?

Asked by: Cweed
We recommend using one our exclusive Mouse IgG Binding Proteins as a secondary detection reagent. A complete list of available binding proteins is available on our website here: https://www.scbt.com/scbt/browse/support-products-mouse-igg-binding-proteins/_/N-ecrety
Answered by: TechService7
Date published: 2016-12-30
  • y_2025, m_9, d_10, h_9CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_3
  • loc_ko_KR, sid_101595, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 117ms
  • QUESTIONS, PRODUCT
Rated 4 out of 5 by from Clean backgroundThe antibody didn't detect the bands I expected to see, but I believe that my sample is more responsible than the antibody. The background, however, was much cleaner than other strep-tag antibodies.
Date published: 2017-09-06
Rated 5 out of 5 by from clear stripsI used it at 1:500 for western blots, and the result is very good.
Date published: 2017-09-05
Rated 5 out of 5 by from Good resultsI got strong band at dilution 1:500, my experimental result was very well.
Date published: 2017-05-13
Rated 5 out of 5 by from positive resultsThis antibody was used in WB is excellent, strong signal
Date published: 2017-04-24
Rated 5 out of 5 by from Good for wbWe used this in WB and we got a strong signal and clean background.
Date published: 2017-02-07
Rated 5 out of 5 by from Published antibodyPublished in several publications with drosophila and human samples by IP, WB and IF
Date published: 2017-01-13
Rated 5 out of 5 by from Good wbGood for western blot application;includes full set of diterct conjugates
Date published: 2017-01-01
Rated 4 out of 5 by from Used it in WB and worked well at 1:250 dilutionUsed it in WB and worked well at 1:250 dilution.
Date published: 2015-06-16
  • y_2025, m_9, d_10, h_9
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_10
  • loc_ko_KR, sid_101595, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 13ms
  • REVIEWS, PRODUCT
SBP Tag 항체 (SB19-C4) is rated 4.4 out of 5 by 10.
  • y_2025, m_9, d_10, h_9
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_10
  • loc_ko_KR, sid_101595, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 102ms
  • REVIEWS, PRODUCT