Date published: 2026-2-4

1-800-457-3801

SCBT Portrait Logo
Seach Input

Axin 항체 (2B11): sc-293190

4.7(6)
리뷰 쓰기질문하기

데이터 시트
  • Axin 항체 2B11 는 마우스 monoclonal IgG2a κ Axin 항체, 11간행물에 인용, 이며 100 µg/ml으로 제공합니다.
  • human origin의 Axin에서 내부에 위치한 643-740 아미노산을 항원으로 사용하였습니다.
  • WB, IP, IF, IHC(P) 와ELISA으로 human origin의 Axin을 검출할것을 권장합니다.
  • m-IgG Fc BP-HRP2a BP-HRP">m-IgG2a BP-HRP 는 Axin 항체 (2B11) WB 및 IHC(P) 애플리케이션용입니다. 이 시약은 이제 Axin 항체 (2B11)와 함께 번들로 제공됩니다(아래 주문 정보 참조).
Crispr Promo Banner

빠른 링크

더보기

액신 항체(2B11)는 웨스턴 블롯(WB), 면역침전법(IP), 면역형광법(IF), 면역조직화학, 효소결합면역흡착분석법(ELISA)을 통해 인간 유래 액신 단백질을 검출하는 마우스 단일클론 IgG2a 카파 경쇄 항체입니다. 항액신 항체(2B11)는 비접합 형태로 이용 가능합니다. 액신은 세포 증식, 분화, 배아 발달 등 다양한 세포 과정에 필수적인 Wnt 신호 전달 경로를 조절하는 데 중요한 역할을 합니다. 액신은 스캐폴드 역할을 함으로써 β-카테닌, 선종성 대장용종증(APC), 글리코겐 신타제 키나제 3 베타(GSK-3β)를 포함하는 복합체의 형성을 촉진하여 β-카테닌의 분해를 촉진합니다. 이러한 분해는 비정상적인 Wnt 신호 전달을 방지하여 통제되지 않은 세포 성장과 암으로 이어질 수 있습니다. 액신의 구조적 완전성은 여러 결합 영역을 통해 효과적인 단백질-단백질 상호작용을 가능하게 하여 신호 전달 경로에서 효율적인 파트너 결합을 가능하게 합니다. 액신과 액신과 45%의 동일성을 공유하는 컨덕틴과 같은 다른 단백질 간의 상호작용은 Wnt 신호 전달의 균형을 유지하는 데 있어 액신의 중요성과 종양 발생에 미치는 영향을 강조합니다.

연구용으로만 사용가능합니다. 진단이나 치료용으로 사용불가합니다.

Alexa Fluor®는 미국 오리건주 Molecular Probes Inc.의 상표입니다.

LI-COR®와 Odyssey®는 LI-COR Biosciences의 등록 상표입니다.

Axin 항체 (2B11) 참고문헌:

  1. 액신과 발암의 연관성.  |  Salahshor, S. and Woodgett, JR. 2005. J Clin Pathol. 58: 225-36. PMID: 15735151
  2. 탄키라제 억제는 액신을 안정화시키고 Wnt 신호를 길항합니다.  |  Huang, SM., et al. 2009. Nature. 461: 614-20. PMID: 19759537
  3. 표준 Wnt 신호 전달 경로에서 액신 기능의 조절에 대한 새로운 통찰력.  |  Song, X., et al. 2014. Protein Cell. 5: 186-93. PMID: 24474204
  4. 대뇌 피질 발달에서 액신의 새로운 역할.  |  Ye, T., et al. 2015. Front Cell Neurosci. 9: 217. PMID: 26106297
  5. 생체 분자 응축물 내 액신의 인산화는 탄키라제 매개 분해를 상쇄합니다.  |  Klement, K., et al. 2023. J Cell Sci. 136: PMID: 37721093
  6. R-스폰딘-1은 LRP6-CK1ε 축을 통해 액신 분해를 유도합니다.  |  Tan, L., et al. 2024. Cell Commun Signal. 22: 14. PMID: 38183076
  7. APC 돌연변이는 액신 상분리에 의해 조직된 β-카테닌 파괴 복합체의 응축을 방해합니다.  |  Zhang, D., et al. 2024. Cell Mol Life Sci. 81: 57. PMID: 38279052
  8. E-카데린과 APC는 베타카테닌 및 세포 골격과의 상호 작용을 위해 경쟁합니다.  |  Hülsken, J., et al. 1994. J Cell Biol. 127: 2061-9. PMID: 7806582
  9. 베타 카테닌과 전사인자 LEF-1의 기능적 상호 작용.  |  Behrens, J., et al. 1996. Nature. 382: 638-42. PMID: 8757136
  10. 마우스 융합 유전자좌는 배아 축 형성을 조절하는 Wnt 신호 전달 경로의 억제제인 Axin을 암호화합니다.  |  Zeng, L., et al. 1997. Cell. 90: 181-92. PMID: 9230313
  11. 베타카테닌은 유비퀴틴-프로테아좀 경로의 표적입니다.  |  Aberle, H., et al. 1997. EMBO J. 16: 3797-804. PMID: 9233789
  12. 액신 동족체인 콘덕틴과 베타카테닌, APC 및 GSK3베타의 기능적 상호 작용.  |  Behrens, J., et al. 1998. Science. 280: 596-9. PMID: 9554852

주문정보

제품명카탈로그 번호 단위가격수량관심품목

Axin 항체 (2B11)

sc-293190
100 µg/ml
CNY2422.00

Axin (2B11): m-IgG Fc BP-HRP 번들

sc-540275
100 µg Ab; 10 µg BP
CNY2715.00

Axin (2B11): m-IgG2a BP-HRP 번들

sc-546880
100 µg Ab; 10 µg BP
CNY2715.00

Does this antibody recognise Axin1 or Axin2?

Asked by: Anatomical Science
Thank you for the question. This antibody recognizes Axin1. It was raised against human AXIN1 amino acids 643-740 from protein accession number O15169. The Sequence was ISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRA.
Answered by: Technical Support Europe
Date published: 2018-01-09

Can sc-293190: Axin (2B11) monoclonal antibody be used to stain formalin-fixed, paraffin-embedded (FFPE) tissue sections?

Asked by: Trav11
Thank you for your question. Yes, sc-293190: Axin (2B11) is recommended for use in IHC with paraffin-embedded sections. We recommend performing antigen retrieval with sodium citrate buffer (pH 6) and heat. The full protocol can be found here: https://www.scbt.com/scbt/resources/protocols/immunoperoxidase-staining
Answered by: Technical Support
Date published: 2017-03-24
  • y_2026, m_2, d_3, h_5CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_2
  • loc_ko_KR, sid_293190, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 178ms
  • QUESTIONS, PRODUCT
Rated 4 out of 5 by from Great featureI used this antibody in ovarian cancer cells in EMT. It works very well. Good signal at the right size. Dilution used: (1/300 to 1/500)
Date published: 2018-11-22
Rated 5 out of 5 by from fluorescent ICCI got good immunofluorescent images of paraformaldehyde-fixed mouse embryonic fibloblast (MEF) cells using axin (2B11) antibody under confocal microscope. Axin is well distributed in all cytoplasm except nucleus. It works very well
Date published: 2018-02-01
Rated 4 out of 5 by from does detect endogenous Axin in HEK293Additional bands at 60,45, 30 and 15kDa when HEK293 is used
Date published: 2018-01-03
Rated 5 out of 5 by from Western blot looks niceAt dilution of 1:500, this antibody worked in overexpressed HEK cells. Although not included, we do not see a good bad in non overexpressed HEK cells loaded at 25ug lysates protein. But the immunofluoresence used at 1:50 works really well in HEK non overexpressed cells.
Date published: 2017-12-12
Rated 5 out of 5 by from specific resultThis antibody is very strong, accurate. I like it. The Axin antibody doesn't requires any optimisation,just use the dilution 1:500, It is highly specific for the targett protein.
Date published: 2017-07-22
Rated 5 out of 5 by from very efficientI am very glad that this antibody is very efficient. I used Axin antibody of 1:500 dilution in WB.,loaded 60 ug.
Date published: 2017-05-23
  • y_2026, m_2, d_3, h_5
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_6
  • loc_ko_KR, sid_293190, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 14ms
  • REVIEWS, PRODUCT
Axin 항체 (2B11) is rated 4.7 out of 5 by 6.
  • y_2026, m_2, d_3, h_5
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_6
  • loc_ko_KR, sid_293190, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 232ms
  • REVIEWS, PRODUCT