Date published: 2026-4-5

1-800-457-3801

SCBT Portrait Logo
Seach Input

Anticorps SBP Tag (SB19-C4): sc-101595

4.4(10)
Écrire une critiquePoser une question

Fiches techniques
  • L'anticorps SBP Tag SB19-C4 est un monoclonal IgG1 κ L'Anticorps SBP Tag, cité dans 58 publications, fourni en 200 µg/ml
  • élevé contre le peptide de liaison à la streptavidine
  • L'Anticorps SBP Tag (SB19-C4) est recommandé pour la détection de SBP tag par WB et IF
  • L'Anticorps SBP Tag (SB19-C4) est disponible conjugué à l'agarose pour IP; et soit à la phycoerythrin ou FITC our IF, IHC(P) et FCM
  • aussi disponible conjugué à l'Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 ou Alexa Fluor® 647 pour WB (RGB), IF, IHC(P) et FCM
  • aussi disponible conjugué à l'Alexa Fluor® 680 ou Alexa Fluor® 790 pour WB (NIR), IF et FCM
  • Nous testons actuellement encore nos anticorps secondaires pour trouver la meilleure protéine de liaison pour cet anticorps primaire SBP Tag (SB19-C4). Veuillez nous contacter si vous avez des questions concernant les réactifs de détection secondaire appropriés.
Gene Editing Promo Banner

ACCÈS RAPIDE AUX LIENS

VOIR ÉGALEMENT...

L'anticorps SBP Tag (SB19-C4) est un anticorps monoclonal de souris IgG1 κ SBP Tag (également appelé anticorps Streptavidin-Binding Peptide, anticorps SBP-Tag, anticorps SBP tag 38 acides aminés, anticorps SBP, ou anticorps MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) qui détecte la protéine SBP Tag par WB et IF. L'anticorps SBP Tag (SB19-C4) est disponible sous forme d'anticorps anti-SBP Tag non conjugué, ainsi que sous plusieurs formes conjuguées d'anticorps anti-SBP Tag, y compris agarose, PE, FITC et plusieurs conjugués Alexa Fluor®. La streptavidine, une protéine tétramérique purifiée à partir de Streptomyces avidinii, se lie très étroitement à la biotine avec un Kd de 10-14 mol/l, formant l'une des plus fortes interactions biologiques et non covalentes connues. Chaque monomère de streptavidine lie une molécule de biotine. La forte liaison streptavidine-biotine peut être utilisée pour "coller" divers produits chimiques sur des surfaces et pour relier des molécules telles que des radio-isotopes et des anticorps monoclonaux. La streptavidine est largement utilisée dans les laboratoires scientifiques, généralement pour la purification des produits immunochimiques, et c'est l'un des composants les plus importants des kits de diagnostic et de laboratoire. Le Tag SBP (Streptavidin binding protein Tag) est une séquence d'affinité protéique de 38 acides aminés qui se lie à la streptavidine et peut être utilisée pour la détection et la purification d'une variété de protéines recombinantes.

Pour la Recherche Uniquement. Non destiné à un usage diagnostique ou thérapeutique.

Alexa Fluor® est une marque déposée de Molecular Probes Inc., OR., USA

LI-COR® et Odyssey® sont marques déposées de LI-COR Biosciences

Anticorps SBP Tag (SB19-C4) Références:

  1. Purification en une étape de protéines recombinantes à l'aide d'un peptide de liaison à la streptavidine à affinité nanomolaire, le SBP-Tag.  |  Keefe, AD., et al. 2001. Protein Expr Purif. 23: 440-6. PMID: 11722181
  2. Échange de ligands entre protéines. Échange de biotine et de dérivés de biotine entre l'avidine et la streptavidine.  |  Pazy, Y., et al. 2002. J Biol Chem. 277: 30892-900. PMID: 12055191
  3. Génie génétique d'un anticorps contre le virus de l'encéphalite équine vénézuélienne, marqué par un peptide de liaison à la streptavidine et un fragment variable à chaîne unique.  |  Hu, WG., et al. 2002. Hybrid Hybridomics. 21: 415-20. PMID: 12573105
  4. Le Nano-tag, un peptide se liant à la streptavidine pour la purification et la détection des protéines recombinantes.  |  Lamla, T. and Erdmann, VA. 2004. Protein Expr Purif. 33: 39-47. PMID: 14680960
  5. Un partenaire de solubilité favorable pour l'expression recombinante de la streptavidine.  |  Sørensen, HP., et al. 2003. Protein Expr Purif. 32: 252-9. PMID: 14965771
  6. Interactions coopératives de liaisons hydrogène dans le système streptavidine-biotine.  |  Hyre, DE., et al. 2006. Protein Sci. 15: 459-67. PMID: 16452627
  7. Une streptavidine monovalente avec un seul site de liaison femtomolaire pour la biotine.  |  Howarth, M., et al. 2006. Nat Methods. 3: 267-73. PMID: 16554831
  8. Structure à haute résolution de la (+)-épi-biotine liée à la streptavidine.  |  Le Trong, I., et al. 2006. Acta Crystallogr D Biol Crystallogr. 62: 576-81. PMID: 16699183
  9. Analyse de la liaison protéine-ADN par pulldown streptavidine-agarose.  |  Wu, KK. 2006. Methods Mol Biol. 338: 281-90. PMID: 16888365
  10. Le SMC2 marqué au peptide de liaison à la streptavidine (SBP) permet la fluorescence d'affinité en une seule étape, le blotting ou la purification du complexe de condensine.  |  Kim, JH., et al. 2010. BMC Biochem. 11: 50. PMID: 21194474
  11. Conception, guidée par la structure, d'une streptavidine modifiée réutilisable pour purifier des protéines marquées par un peptide de liaison à la streptavidine ou des protéines biotinylées.  |  Wu, SC. and Wong, SL. 2013. PLoS One. 8: e69530. PMID: 23874971
  12. Purification par affinité en une seule étape des complexes de signalisation ERK à l'aide de la balise Streptavidin-Binding Peptide (SBP).  |  Yang, L. and Veraksa, A. 2017. Methods Mol Biol. 1487: 113-126. PMID: 27924562

Informations pour la commande

Nom du produitRef. CatalogueCOND.Prix HTQTÉFavoris

Anticorps SBP Tag (SB19-C4)

sc-101595
200 µg/ml
CNY2422.00

Anticorps SBP Tag (SB19-C4) AC

sc-101595 AC
500 µg/ml, 25% agarose
CNY3189.00

Anticorps SBP Tag (SB19-C4) FITC

sc-101595 FITC
200 µg/ml
CNY2527.00

Anticorps SBP Tag (SB19-C4) PE

sc-101595 PE
200 µg/ml
CNY2625.00

Anticorps SBP Tag (SB19-C4) Alexa Fluor® 488

sc-101595 AF488
200 µg/ml
CNY2738.00

Anticorps SBP Tag (SB19-C4) Alexa Fluor® 546

sc-101595 AF546
200 µg/ml
CNY2738.00

Anticorps SBP Tag (SB19-C4) Alexa Fluor® 594

sc-101595 AF594
200 µg/ml
CNY2738.00

Anticorps SBP Tag (SB19-C4) Alexa Fluor® 647

sc-101595 AF647
200 µg/ml
CNY2738.00

Anticorps SBP Tag (SB19-C4) Alexa Fluor® 680

sc-101595 AF680
200 µg/ml
CNY2738.00

Anticorps SBP Tag (SB19-C4) Alexa Fluor® 790

sc-101595 AF790
200 µg/ml
CNY2738.00

I am looking for an antibody that recognizes the SBP tag and can be used for immunoprecipitation (ChIP). Will this antibody work? If not, could you point me to one that will?

Posée par: MTStan
Thank you for your question. This antibody has not yet been tested for IP or ChIP applications. We are aware of a couple of product citations using this antibody for IP (PMID's: 2402161 and 25412508), but nothing yet for ChIP. The agarose conjugated antibody is recommended and warrantied for immunoprecipitation (IP), however we are still gathering data to show on our website. Check back for updates!
Répondue par: Technical Support
Date de publication: 2020-02-06

I have (sc-101595) SBP Tag-HRP ab. What is the dilution you recommend for ELISA? Thanks,

Posée par: yangm6
Thank you for your question. We do not have established dilutions for ELISA for our antibodies as they require titration. You can find our ELISA protocol on the website here: https://www.scbt.com/scbt/resources/protocols/elisa-assays
Répondue par: Technical Service
Date de publication: 2017-07-14

I have run out of the goat anti-mouse secondary antibody I usually use for WB detection. What do you recommend I use?

Posée par: Cweed
We recommend using one our exclusive Mouse IgG Binding Proteins as a secondary detection reagent. A complete list of available binding proteins is available on our website here: https://www.scbt.com/scbt/browse/support-products-mouse-igg-binding-proteins/_/N-ecrety
Répondue par: TechService7
Date de publication: 2016-12-30
  • y_2026, m_4, d_2, h_10CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_3
  • loc_fr_FR, sid_101595, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 105ms
  • QUESTIONS, PRODUCT
Rated 4 de 5 de par Clean backgroundThe antibody didn't detect the bands I expected to see, but I believe that my sample is more responsible than the antibody. The background, however, was much cleaner than other strep-tag antibodies.
Date de publication: 2017-09-06
Rated 5 de 5 de par clear stripsI used it at 1:500 for western blots, and the result is very good.
Date de publication: 2017-09-05
Rated 5 de 5 de par Good resultsI got strong band at dilution 1:500, my experimental result was very well.
Date de publication: 2017-05-13
Rated 5 de 5 de par positive resultsThis antibody was used in WB is excellent, strong signal
Date de publication: 2017-04-24
Rated 5 de 5 de par Good for wbWe used this in WB and we got a strong signal and clean background.
Date de publication: 2017-02-07
Rated 5 de 5 de par Published antibodyPublished in several publications with drosophila and human samples by IP, WB and IF
Date de publication: 2017-01-13
Rated 5 de 5 de par Good wbGood for western blot application;includes full set of diterct conjugates
Date de publication: 2017-01-01
Rated 4 de 5 de par Used it in WB and worked well at 1:250 dilutionUsed it in WB and worked well at 1:250 dilution.
Date de publication: 2015-06-16
  • y_2026, m_4, d_2, h_10
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_10
  • loc_fr_FR, sid_101595, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 21ms
  • REVIEWS, PRODUCT
Anticorps SBP Tag (SB19-C4) est évalué 4.4 de 5 de 10.
  • y_2026, m_4, d_2, h_10
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.43
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_10
  • loc_fr_FR, sid_101595, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 117ms
  • REVIEWS, PRODUCT