Date published: 2026-2-11

1-800-457-3801

SCBT Portrait Logo
Seach Input

VIP Anticuerpo (H-6): sc-25347

4.9(11)
Escribir una reseñaHacer una pregunta

Fichas Técnicas
  • VIP Anticuerpo H-6 es un monoclonal de ratón IgG2b κ VIP Anticuerpo, ver las 38 publicaciones, proporcionado como 200 µg/ml
  • producido contra los amino ácidos 1-95 de vasoactive intestinal peptide (VIP) de origen human
  • VIP Anticuerpo (H-6) es recomendado para detectar VIP de human origen, mediante WB, IP, IF, IHC(P) y ELISA
  • VIP Anticuerpo (H-6) es disponible conjugado a agarosa para IP; HRP para WB, IHC(P) y ELISA; y tanto a phycoerythrin como a FITC para IF, IHC(P) y FCM
  • también disponible conjugado a Alexa Fluor® 488, Alexa Fluor® 546, Alexa Fluor® 594 o Alexa Fluor® 647 para WB (RGB), IF, IHC (P) y FCM
  • también disponible conjugado a Alexa Fluor® 680 o Alexa Fluor® 790 para WB (NIR), IF y FCM
  • 2b BP-HRP">m-IgG2b BP-HRP y m-IgGκ BP-HRP son los reactivos de detección secundarios preferidos para VIP Anticuerpo (H-6) para aplicaciones WB e IHC(P). Estos reactivos se ofrecen ahora en paquetes con VIP Anticuerpo (H-6)(véase la información de pedido más abajo).
Crispr Promo Banner

ENLACES RÁPIDOS

VER TAMBIÉN ....

El anticuerpo VIP (H-6) es un anticuerpo monoclonal IgG2b de ratón de cadena ligera kappa diseñado para detectar el péptido intestinal vasoactivo (VIP) humano, también conocido como PHM27 o miembro de la familia del glucagón. El anticuerpo monoclonal VIP (H-6) se cría frente a los aminoácidos 1-95 de la proteína VIP, lo que garantiza una unión precisa y una alta afinidad en diversas técnicas experimentales, como la inmunotransferencia occidental (WB), la inmunoprecipitación (IP), la inmunofluorescencia (IF), la inmunohistoquímica con secciones incluidas en parafina (IHCP) y el ensayo inmunoenzimático (ELISA). El péptido intestinal vasoactivo desempeña un papel fundamental en la relajación del músculo liso y la vasodilatación, regulando así la presión arterial y facilitando la secreción intestinal de agua y electrolitos, lo que subraya su importancia en la investigación cardiovascular y gastrointestinal. Más allá de sus efectos vasodilatadores, el VIP es parte integrante de la neuroprotección, la modulación del sistema inmunitario y presenta propiedades antiinflamatorias, lo que convierte al anticuerpo VIP (H-6) en una herramienta clave en diversos procesos fisiológicos y aplicaciones terapéuticas potenciales. El anticuerpo monoclonal VIP (H-6) está disponible tanto en formas no conjugadas como en múltiples formas conjugadas, incluyendo peroxidasa de rábano picante (HRP), ficoeritrina (PE), isotiocianato de fluoresceína (FITC) y diversos colorantes Alexa Fluor®, lo que proporciona flexibilidad para una amplia gama de montajes experimentales. El anticuerpo anti-VIP (H-6) permite a los científicos estudiar eficazmente los mecanismos en los que interviene el VIP e identificar posibles dianas terapéuticas para afecciones relacionadas con la vasodilatación, la regulación inmunitaria y las respuestas inflamatorias.

Para uso exclusivo en Investigación No está diseñado para para Diagnóstico ó Terapia.

Alexa Fluor® es una marca registrada de Molecular Probes Inc., OR., USA

REIVEW LI-COR® y Odyssey® son marcas registradas de LI-COR Biosciences.

VIP Anticuerpo (H-6) Referencias:

  1. Procesamiento diferencial del proglucagón por las prohormonas convertasas PC2 y PC3 similares a la subtilisina para generar glucagón o péptido similar al glucagón.  |  Rouillé, Y., et al. 1995. J Biol Chem. 270: 26488-96. PMID: 7592866
  2. Expresión y actividad funcional de receptores de glucagón, péptido similar al glucagón I y péptido insulinotrópico dependiente de la glucosa en células de islotes pancreáticos de rata.  |  Moens, K., et al. 1996. Diabetes. 45: 257-61. PMID: 8549871
  3. Intolerancia a la glucosa pero saciedad normal en ratones con una mutación nula en el gen del receptor del péptido 1 similar al glucagón.  |  Scrocchi, LA., et al. 1996. Nat Med. 2: 1254-8. PMID: 8898756
  4. El péptido intestinal vasoactivo (VIP) estimula el crecimiento in vitro de células humanas derivadas de adenocarcinoma pancreático con receptor VIP-1.  |  Jiang, S., et al. 1997. Cancer Res. 57: 1475-80. PMID: 9108448
  5. Características específicas del metabolismo del glucógeno en el hígado.  |  Bollen, M., et al. 1998. Biochem J. 336 (Pt 1): 19-31. PMID: 9806880
  6. El polipéptido activador de la adenilato ciclasa hipofisaria (PACAP) 38 y el PACAP27 activan vías de señalización intracelular comunes y distintas para estimular la secreción de la hormona del crecimiento a partir de los somatotropos porcinos.  |  Martínez-Fuentes, AJ., et al. 1998. Endocrinology. 139: 5116-24. PMID: 9832451

Información sobre pedidos

Nombre del productoNúmero de catálogoUNIDADPrecioCANTIDADFavoritos

VIP Anticuerpo (H-6)

sc-25347
200 µg/ml
CNY2422.00

Paquete de VIP (H-6): m-IgGκ BP-HRP

sc-520782
200 µg Ab, 40 µg BP
CNY2715.00

Paquete de VIP (H-6): m-IgG2b BP-HRP

sc-548853
200 µg Ab; 10 µg BP
CNY2715.00

VIP Anticuerpo (H-6) AC

sc-25347 AC
500 µg/ml, 25% agarose
CNY3189.00

VIP Anticuerpo (H-6) HRP

sc-25347 HRP
200 µg/ml
CNY2422.00

VIP Anticuerpo (H-6) FITC

sc-25347 FITC
200 µg/ml
CNY2527.00

VIP Anticuerpo (H-6) PE

sc-25347 PE
200 µg/ml
CNY2625.00

VIP Anticuerpo (H-6) Alexa Fluor® 488

sc-25347 AF488
200 µg/ml
CNY2738.00

VIP Anticuerpo (H-6) Alexa Fluor® 546

sc-25347 AF546
200 µg/ml
CNY2738.00

VIP Anticuerpo (H-6) Alexa Fluor® 594

sc-25347 AF594
200 µg/ml
CNY2738.00

VIP Anticuerpo (H-6) Alexa Fluor® 647

sc-25347 AF647
200 µg/ml
CNY2738.00

VIP Anticuerpo (H-6) Alexa Fluor® 680

sc-25347 AF680
200 µg/ml
CNY2738.00

VIP Anticuerpo (H-6) Alexa Fluor® 790

sc-25347 AF790
200 µg/ml
CNY2738.00

Can you take a picture of the product‘s package? Can' t find it after cleaning the lab...

Preguntado por: Anónimo
Thank you for your question. Please contact our Technical Service Department. Our Asian Technical Service team is available at (+86) 021-60936350 or [email protected] or by live chat on our website.
Respondida por: Sen Li
Fecha de publicación: 2026-01-30

Hi, does this antibody work with IHC on free floating sections from mouse?

Preguntado por: Dakota
Thank you for your question. For assistance please contact Technical service . Please call 800-457-3801 or email [email protected].
Respondida por: BlakeJ
Fecha de publicación: 2025-07-28

I understand the antibody is supplied at a concentration of 200ug/ml but I don't see information on the VOLUME supplied per tube - is it 50ul?

Preguntado por: ebittman
Thank you for your question. As indicated on the product datasheet, this antibody is supplied as 200 µg in 1 ml PBS with 0.1 % gelatin and <0.1 % sodium azide.
Respondida por: Tech Support Europe
Fecha de publicación: 2021-09-13

Did you test this antibody in flowcytometry ?

Preguntado por: Or1234
Thank you for your question. This antibody has not yet been tested for Flow cytometry so that is not a recommended application at this time. The conjugated form is recommended and warrantied for Flow cytometry use, although we are still gathering data to show on our website. Check back for updates!
Respondida por: Tech Service
Fecha de publicación: 2020-02-10

Please confirm that this is raised against 1-95 of preproVIP and provide the sequence.  VIP is 28 aa on the end of preproVIP and corresponds to 125-152 of that molecule. This is raised against 1-95 and and  NOT 125-152 of preproVIP, correct?

Preguntado por: Susan81
Thank you for your question. Yes, this antibody was raised against amino acids 1-95 of VIP of human origin (accession#P01282).
Respondida por: Tech Service
Fecha de publicación: 2019-08-13

Can this antibody be used in mouse corneal immunofluorescence staining?

Preguntado por: fff993541
Thank you for your question. We have not tested this antibody in mouse samples, and so this is not a recommended species at this time.
Respondida por: Technical Support
Fecha de publicación: 2019-02-13

does it work for fluorescence immunohistochemistry ?

Preguntado por: abii
Thanks for your question. Yes, the antibody is recommended for detection of VIP of human origin by WB, IP, IF, IHC(P) and ELISA. Please contact Technical service for further support.
Respondida por: SCBT Heidelberg Support
Fecha de publicación: 2019-01-06

Was this antibody ever tested for mouse VIP? Also, the website says that this antibody is against aa 1-95 ?? as VIP is a 28aa peptide what was VIP conjugated to?

Preguntado por: ValerieC
Thank you for the question. This antibody is recommended for human tissue samples and it did not show good reactivity on mouse samples in our tests. The WB image was done with the VIP fused to a protein tag and the mol. weight indicated in this image does not refelect the mol. weight. of the endogenously expressed VIP protein. This monoclonal antibody was raised against an antigen consisting of amino acids 1-95 of VIP of human origin with protein accession number P01282, as shown also on our corresponding product website MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLG
Respondida por: Technical Support Europe
Fecha de publicación: 2018-01-10
  • y_2026, m_2, d_10, h_5CST
  • bvseo_bulk, prod_bvqa, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasquestionsanswers, tq_9
  • loc_es_ES, sid_25347, prod, sort_[SortEntry(order=LAST_APPROVED_ANSWER_SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getContent, 101ms
  • QUESTIONS, PRODUCT
Rated 5 de 5 por de Good antibody for IFGood conjugated antibody for IF staining on mouse colon tissues (frozen sections).
Fecha de publicación: 2024-11-07
Rated 5 de 5 por de Ottimo anticorpoAbbiamo utilizzato questo anticorpo su sezioni in paraffina, senza smascheramento e con un'incubazione di un'ora a RT, il risultato è stato molto buono e con un'elevata specificità.
Fecha de publicación: 2023-02-02
Rated 5 de 5 por de It looked greatI ordered this a month ago and it worked great! I will purchase again
Fecha de publicación: 2018-05-04
Rated 5 de 5 por de Very GoodGreat for immunofluorescence in formalin-fixed, paraffin-embedded human skin tissue
Fecha de publicación: 2018-01-31
Rated 5 de 5 por de GoodThe analysis results of WB were very stong and clear, it worked well for WB
Fecha de publicación: 2017-06-08
Rated 5 de 5 por de Feel like a VIPVIP (H-6) is well cited for IF and IHC(P). Gives a strong staining in human colon tissue showing extracellular localization.
Fecha de publicación: 2017-01-11
Rated 4 de 5 por de Positive results in western blot analysisPositive results in western blot analysis of human recombinant VIP fusion protein. -SCBT QC
Fecha de publicación: 2015-07-08
Rated 5 de 5 por de Worked for western blot using crude extractsWorked for western blot using crude extracts from rat retinas. -SCBT Publication Review
Fecha de publicación: 2015-06-02
  • y_2026, m_2, d_10, h_5
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_es_ES, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getReviews, 15ms
  • REVIEWS, PRODUCT
VIP Anticuerpo (H-6) clasificado 4.9 de 5 por 11.
  • y_2026, m_2, d_10, h_5
  • bvseo_bulk, prod_bvrr, vn_bulk_3.0.42
  • cp_1, bvpage1
  • co_hasreviews, tv_0, tr_11
  • loc_es_ES, sid_25347, prod, sort_[SortEntry(order=SUBMISSION_TIME, direction=DESCENDING)]
  • clientName_scbt
  • bvseo_sdk, java_sdk, bvseo-4.0.0
  • CLOUD, getAggregateRating, 100ms
  • REVIEWS, PRODUCT